Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11098
Gene name
LocationContig_961:5907..6126
Strand+
Gene length (bp)219
Transcript length (bp)219
Coding sequence length (bp)219
Protein length (aa) 73

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 1.9E-05 5 35

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29138|CUDP_METAN Cuticle-degrading protease OS=Metarhizium anisopliae GN=PR1 PE=1 SV=1 5 64 1.0E-18
sp|P12547|ORYZ_ASPOR Alkaline protease 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=alp1 PE=1 SV=2 5 65 7.0E-18
sp|B8N106|ORYZ_ASPFN Alkaline protease 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=alp1 PE=1 SV=1 5 65 7.0E-18
sp|Q00208|ORYZ_EMENI Alkaline protease 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alp1 PE=2 SV=1 5 67 6.0E-16
sp|P35211|ORYZ_ASPFL Alkaline protease 1 OS=Aspergillus flavus GN=alp1 PE=1 SV=1 5 65 9.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29138|CUDP_METAN Cuticle-degrading protease OS=Metarhizium anisopliae GN=PR1 PE=1 SV=1 5 64 1.0E-18
sp|P12547|ORYZ_ASPOR Alkaline protease 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=alp1 PE=1 SV=2 5 65 7.0E-18
sp|B8N106|ORYZ_ASPFN Alkaline protease 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=alp1 PE=1 SV=1 5 65 7.0E-18
sp|Q00208|ORYZ_EMENI Alkaline protease 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alp1 PE=2 SV=1 5 67 6.0E-16
sp|P35211|ORYZ_ASPFL Alkaline protease 1 OS=Aspergillus flavus GN=alp1 PE=1 SV=1 5 65 9.0E-16
sp|Q03420|ALP_HYPAT Alkaline proteinase OS=Hypocrea atroviridis GN=prb1 PE=1 SV=1 5 67 2.0E-15
sp|Q68GV9|ALP_LECPS Alkaline serine protease ver112 OS=Lecanicillium psalliotae PE=1 SV=1 5 64 4.0E-15
sp|L8FSM5|SUB2_PSED2 Subtilisin-like protease 2 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP2 PE=3 SV=1 4 65 3.0E-14
sp|P28296|ORYZ_ASPFU Alkaline protease 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alp1 PE=1 SV=2 5 65 6.0E-14
sp|B0Y708|ORYZ_ASPFC Alkaline protease 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=alp1 PE=3 SV=1 5 65 6.0E-14
sp|D4B5N1|SUB9_ARTBC Subtilisin-like protease 9 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB9 PE=3 SV=1 6 65 2.0E-13
sp|A1CIA7|ORYZ_ASPCL Alkaline protease 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=alp1 PE=3 SV=1 5 64 2.0E-13
sp|A1CWF3|ORYZ_NEOFI Alkaline protease 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=alp1 PE=2 SV=1 5 65 3.0E-13
sp|E4UTU7|SUB9_ARTGP Subtilisin-like protease 9 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB9 PE=3 SV=1 6 65 3.0E-13
sp|C5PCX1|SUB7B_COCP7 Subtilisin-like protease CPC735_015300 OS=Coccidioides posadasii (strain C735) GN=CPC735_015300 PE=3 SV=1 3 67 1.0E-12
sp|L8G6I7|SUB1_PSED2 Subtilisin-like protease 1 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP1 PE=1 SV=1 8 65 2.0E-12
sp|D4D674|SUB9_TRIVH Subtilisin-like protease 9 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB9 PE=3 SV=1 6 65 6.0E-12
sp|C5FPS1|SUB1_ARTOC Subtilisin-like protease 1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB1 PE=3 SV=1 3 69 7.0E-12
sp|C5P6L5|SUB4C_COCP7 Subtilisin-like protease CPC735_024010 OS=Coccidioides posadasii (strain C735) GN=CPC735_024010 PE=3 SV=1 6 67 1.0E-11
sp|Q9Y778|SMP1_MAGPO Subtilisin-like proteinase Mp1 OS=Magnaporthiopsis poae PE=1 SV=1 2 64 2.0E-11
sp|Q8J0D9|SUB1_ARTOT Subtilisin-like protease 1 OS=Arthroderma otae GN=SUB1 PE=3 SV=1 2 69 3.0E-11
sp|C5FH27|SUB9_ARTOC Subtilisin-like protease 9 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB9 PE=3 SV=1 2 65 6.0E-11
sp|Q69F58|SUB1_TRIRU Subtilisin-like protease 1 OS=Trichophyton rubrum GN=SUB1 PE=2 SV=1 2 70 2.0E-10
sp|Q5VJ77|SUB1_TRIVC Subtilisin-like protease 1 (Fragment) OS=Trichophyton verrucosum GN=SUB1 PE=3 SV=1 3 64 3.0E-10
sp|Q64K30|SUB1_ARTBE Subtilisin-like protease 1 (Fragment) OS=Arthroderma benhamiae GN=SUB1 PE=3 SV=1 3 64 3.0E-10
sp|D4AX50|SUB8_ARTBC Subtilisin-like protease 8 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB8 PE=3 SV=1 5 68 3.0E-10
sp|E4V4J8|SUB6_ARTGP Subtilisin-like protease 6 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB6 PE=3 SV=1 3 65 3.0E-10
sp|Q3ZEJ8|SUB6_TRITO Subtilisin-like protease 6 OS=Trichophyton tonsurans GN=SUB6 PE=3 SV=1 5 65 4.0E-10
sp|A1XIH1|SUB6_TRISD Subtilisin-like protease 6 OS=Trichophyton soudanense GN=SUB6 PE=1 SV=1 5 65 4.0E-10
sp|Q9UW97|SUB6_TRIRU Subtilisin-like protease 6 OS=Trichophyton rubrum GN=SUB6 PE=1 SV=1 5 65 4.0E-10
sp|A1XIH0|SUB6_TRIEQ Subtilisin-like protease 6 OS=Trichophyton equinum GN=SUB6 PE=1 SV=1 5 65 4.0E-10
sp|P20015|PRTT_ENGAL Proteinase T (Fragment) OS=Engyodontium album GN=PROT PE=1 SV=1 7 64 4.0E-10
sp|D4DKQ4|SUB8_TRIVH Subtilisin-like protease 8 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB8 PE=3 SV=1 5 68 5.0E-10
sp|B8XGQ7|SUB4_TRITO Subtilisin-like protease 4 OS=Trichophyton tonsurans GN=SUB4 PE=3 SV=1 2 67 5.0E-10
sp|D4DIW9|SUB1_TRIVH Subtilisin-like protease 1 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB1 PE=3 SV=1 2 70 6.0E-10
sp|D4AKU9|SUB1_ARTBC Subtilisin-like protease 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB1 PE=2 SV=2 2 70 6.0E-10
sp|D4D5H3|SUB6_TRIVH Subtilisin-like protease 6 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB6 PE=3 SV=1 3 65 6.0E-10
sp|C5P5Q3|SUB9_COCP7 Subtilisin-like protease CPC735_033790 OS=Coccidioides posadasii (strain C735) GN=CPC735_033790 PE=3 SV=1 4 63 6.0E-10
sp|C5FII2|SUB8_ARTOC Subtilisin-like protease 8 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB8 PE=3 SV=1 5 72 6.0E-10
sp|Q5VJ72|SUB6_TRIVC Subtilisin-like protease 6 OS=Trichophyton verrucosum GN=SUB6 PE=3 SV=1 3 65 9.0E-10
sp|B8XGQ4|SUB1_TRITO Subtilisin-like protease 1 OS=Trichophyton tonsurans GN=SUB1 PE=3 SV=1 3 69 1.0E-09
sp|B6VA84|SUB1_TRIEQ Subtilisin-like protease 1 OS=Trichophyton equinum GN=SUB1 PE=3 SV=1 3 69 2.0E-09
sp|A7UKV6|SUB4_TRIEQ Subtilisin-like protease 4 (Fragment) OS=Trichophyton equinum GN=SUB4 PE=3 SV=1 2 64 2.0E-09
sp|P40903|ISP6_SCHPO Sexual differentiation process putative subtilase-type proteinase isp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp6 PE=2 SV=1 5 67 2.0E-09
sp|D4D6Q4|SUB4_TRIVH Subtilisin-like protease 4 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB4 PE=3 SV=1 2 67 2.0E-09
sp|Q5VJ74|SUB4_TRIVC Subtilisin-like protease 4 OS=Trichophyton verrucosum GN=SUB4 PE=3 SV=1 2 67 2.0E-09
sp|Q64K33|SUB4_ARTBE Subtilisin-like protease 4 OS=Arthroderma benhamiae GN=SUB4 PE=3 SV=1 2 67 2.0E-09
sp|D4AXW3|SUB4_ARTBC Subtilisin-like protease 4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB4 PE=1 SV=2 2 67 2.0E-09
sp|Q64K31|SUB6_ARTBE Subtilisin-like protease 6 OS=Arthroderma benhamiae GN=SUB6 PE=3 SV=1 5 65 3.0E-09
sp|D4ALV9|SUB6_ARTBC Subtilisin-like protease 6 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB6 PE=2 SV=1 5 65 3.0E-09
sp|P06873|PRTK_ENGAL Proteinase K OS=Engyodontium album GN=PROK PE=1 SV=2 6 63 4.0E-09
sp|Q8J0D7|SUB3_ARTOT Subtilisin-like protease 3 OS=Arthroderma otae GN=SUB3 PE=1 SV=1 2 65 5.0E-09
sp|C5FMY5|SUB3_ARTOC Subtilisin-like protease 3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB3 PE=3 SV=1 2 65 5.0E-09
sp|Q69F35|SUB4_TRIRU Subtilisin-like protease 4 OS=Trichophyton rubrum GN=SUB4 PE=1 SV=1 2 67 5.0E-09
sp|E4UN97|SUB3_ARTGP Subtilisin-like protease 3 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB3 PE=3 SV=1 2 67 5.0E-09
sp|C5P6D1|SUB2A_COCP7 Subtilisin-like protease CPC735_023170 OS=Coccidioides posadasii (strain C735) GN=CPC735_023170 PE=3 SV=1 7 65 6.0E-09
sp|Q69F56|SUB3_TRIRU Subtilisin-like protease 3 OS=Trichophyton rubrum GN=SUB3 PE=1 SV=1 2 65 9.0E-09
sp|P87184|ALP2_ASPFU Alkaline protease 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alp2 PE=1 SV=1 5 64 1.0E-08
sp|B0Y473|ALP2_ASPFC Alkaline protease 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=alp2 PE=3 SV=1 5 64 1.0E-08
sp|D4D1U5|SUB12_TRIVH Subtilisin-like protease 12 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB12 PE=3 SV=1 7 65 1.0E-08
sp|D4AQA9|SUB12_ARTBC Subtilisin-like protease 12 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB12 PE=3 SV=1 7 64 1.0E-08
sp|C5P906|SUB2B_COCP7 Subtilisin-like protease CPC735_003880 OS=Coccidioides posadasii (strain C735) GN=CPC735_003880 PE=3 SV=1 9 70 1.0E-08
sp|C5PCB1|SUB4A_COCP7 Subtilisin-like protease CPC735_066880 OS=Coccidioides posadasii (strain C735) GN=CPC735_066880 PE=3 SV=1 3 64 1.0E-08
sp|C5P9H3|SUB7D_COCP7 Subtilisin-like protease CPC735_005570 OS=Coccidioides posadasii (strain C735) GN=CPC735_005570 PE=3 SV=1 3 64 2.0E-08
sp|E4UWA4|SUB4_ARTGP Subtilisin-like protease 4 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB4 PE=3 SV=1 2 67 2.0E-08
sp|D4DLA2|SUB3_TRIVH Subtilisin-like protease 3 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB3 PE=3 SV=1 2 65 3.0E-08
sp|Q5VJ75|SUB3_TRIVC Subtilisin-like protease 3 OS=Trichophyton verrucosum GN=SUB3 PE=3 SV=1 2 65 3.0E-08
sp|Q64K34|SUB3_ARTBE Subtilisin-like protease 3 OS=Arthroderma benhamiae GN=SUB3 PE=1 SV=1 2 65 3.0E-08
sp|D4AWY5|SUB3_ARTBC Subtilisin-like protease 3 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB3 PE=1 SV=1 2 65 3.0E-08
sp|C5P4Z8|SUB8_COCP7 Subtilisin-like protease CPC735_031240 OS=Coccidioides posadasii (strain C735) GN=CPC735_031240 PE=3 SV=1 5 64 3.0E-08
sp|P23653|PRTR_ENGAL Proteinase R OS=Engyodontium album GN=PROR PE=1 SV=1 6 63 4.0E-08
sp|E4UY04|SUB12_ARTGP Subtilisin-like protease 12 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB12 PE=3 SV=1 7 65 4.0E-08
sp|P09232|PRTB_YEAST Cerevisin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRB1 PE=1 SV=1 6 68 5.0E-08
sp|E4UPZ4|SUB1_ARTGP Subtilisin-like protease 1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB1 PE=3 SV=1 2 64 6.0E-08
sp|P29118|ALP_ACRCH Alkaline proteinase OS=Acremonium chrysogenum GN=ALP PE=3 SV=1 5 65 7.0E-08
sp|B8XGQ6|SUB3_TRITO Subtilisin-like protease 3 OS=Trichophyton tonsurans GN=SUB3 PE=3 SV=1 2 67 7.0E-08
sp|B6VA86|SUB3_TRIEQ Subtilisin-like protease 3 OS=Trichophyton equinum GN=SUB3 PE=3 SV=1 2 67 8.0E-08
sp|Q5VJ76|SUB2_TRIVC Subtilisin-like protease 2 OS=Trichophyton verrucosum GN=SUB2 PE=3 SV=2 5 67 1.0E-07
sp|D4DLI5|SUB2_TRIVH Subtilisin-like protease 2 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB2 PE=3 SV=2 5 67 1.0E-07
sp|D4AZ75|SUB2_ARTBC Subtilisin-like protease 2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB2 PE=2 SV=2 5 67 1.0E-07
sp|Q9UTS0|PSP3_SCHPO Subtilase-type proteinase psp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psp3 PE=2 SV=1 7 66 1.0E-07
sp|Q64K35|SUB2_ARTBE Subtilisin-like protease 2 OS=Arthroderma benhamiae GN=SUB2 PE=3 SV=2 5 67 1.0E-07
sp|E4V2V9|SUB7_ARTGP Subtilisin-like protease 7 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB7 PE=3 SV=1 3 65 2.0E-07
sp|C5FXZ6|SUB4_ARTOC Subtilisin-like protease 4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB4 PE=3 SV=1 2 67 2.0E-07
sp|G1X8P8|SPAZ_ARTOA Cuticle-degrading serine protease OS=Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491) PE=1 SV=1 6 64 2.0E-07
sp|Q8J077|SUB6_TRISH Subtilisin-like protease 6 (Fragment) OS=Trichophyton schoenleinii GN=SUB6 PE=1 SV=1 5 62 3.0E-07
sp|C5NZ70|SUB2C_COCP7 Subtilisin-like protease CPC735_013710 OS=Coccidioides posadasii (strain C735) GN=CPC735_013710 PE=3 SV=1 8 67 3.0E-07
sp|C5FQI3|SUB6_ARTOC Subtilisin-like protease 6 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB6 PE=3 SV=1 3 65 4.0E-07
sp|A1XIH4|SUB7_TRITO Subtilisin-like protease 7 OS=Trichophyton tonsurans GN=SUB7 PE=1 SV=1 3 65 6.0E-07
sp|A1XIH3|SUB7_TRIEQ Subtilisin-like protease 7 OS=Trichophyton equinum GN=SUB7 PE=1 SV=1 3 65 7.0E-07
sp|L8GD75|SUB3_PSED2 Subtilisin-like protease 3 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP3 PE=3 SV=1 6 63 7.0E-07
sp|C5G168|SUB2_ARTOC Subtilisin-like protease 2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB2 PE=3 SV=1 5 67 9.0E-07
sp|Q8J0D8|SUB2_ARTOT Subtilisin-like protease 2 OS=Arthroderma otae GN=SUB2 PE=3 SV=2 5 67 9.0E-07
sp|B8XGQ5|SUB2_TRITO Subtilisin-like protease 2 OS=Trichophyton tonsurans GN=SUB2 PE=3 SV=2 5 67 9.0E-07
sp|B6VA85|SUB2_TRIEQ Subtilisin-like protease 2 OS=Trichophyton equinum GN=SUB2 PE=3 SV=1 5 67 9.0E-07
sp|P58371|SPM1_MAGO7 Subtilisin-like proteinase Spm1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SPM1 PE=3 SV=1 5 64 1.0E-06
sp|Q69F57|SUB2_TRIRU Subtilisin-like protease 2 OS=Trichophyton rubrum GN=SUB2 PE=3 SV=2 5 67 1.0E-06
sp|E4UZP9|SUB2_ARTGP Subtilisin-like protease 2 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB2 PE=3 SV=1 5 67 1.0E-06
sp|C5P1W9|SU11A_COCP7 Subtilisin-like protease CPC735_035780 OS=Coccidioides posadasii (strain C735) GN=CPC735_035780 PE=3 SV=1 3 63 2.0E-06
sp|C5PGK9|SUB7A_COCP7 Subtilisin-like protease CPC735_050320 OS=Coccidioides posadasii (strain C735) GN=CPC735_050320 PE=3 SV=1 3 67 3.0E-06
sp|C5G1D1|SUB5_ARTOC Subtilisin-like protease 5 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB5 PE=3 SV=1 2 65 3.0E-06
sp|C5PFR5|SU11B_COCP7 Subtilisin-like protease CPC735_047380 OS=Coccidioides posadasii (strain C735) GN=CPC735_047380 PE=3 SV=1 2 67 6.0E-06
sp|C5NZ69|SUB7C_COCP7 Subtilisin-like protease CPC735_013700 OS=Coccidioides posadasii (strain C735) GN=CPC735_013700 PE=3 SV=1 6 66 7.0E-06
sp|P25036|YSP3_YEAST Subtilisin-like protease 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP3 PE=2 SV=2 6 64 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0004175 endopeptidase activity No
GO:0071704 organic substance metabolic process No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0008236 serine-type peptidase activity No
GO:0003674 molecular_function No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0017171 serine hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11098
MAGQNTISGTSMASPHVCGLGAYLASVEGFSSPQALCNRIRELATQDVIKGLPAGTANLLAYNGNEQDGEEE*
Coding >Hirsu2|11098
ATGGCGGGACAGAACACGATCAGCGGGACGAGCATGGCGTCGCCGCACGTCTGCGGGCTGGGGGCGTACCTGGCG
TCGGTGGAGGGCTTCAGCAGCCCGCAGGCGCTATGCAACCGGATCCGCGAGCTGGCGACGCAGGACGTGATCAAG
GGCCTGCCGGCCGGGACGGCGAACCTGCTGGCCTACAACGGGAACGAGCAGGACGGGGAGGAGGAGTAA
Transcript >Hirsu2|11098
ATGGCGGGACAGAACACGATCAGCGGGACGAGCATGGCGTCGCCGCACGTCTGCGGGCTGGGGGCGTACCTGGCG
TCGGTGGAGGGCTTCAGCAGCCCGCAGGCGCTATGCAACCGGATCCGCGAGCTGGCGACGCAGGACGTGATCAAG
GGCCTGCCGGCCGGGACGGCGAACCTGCTGGCCTACAACGGGAACGAGCAGGACGGGGAGGAGGAGTAA
Gene >Hirsu2|11098
ATGGCGGGACAGAACACGATCAGCGGGACGAGCATGGCGTCGCCGCACGTCTGCGGGCTGGGGGCGTACCTGGCG
TCGGTGGAGGGCTTCAGCAGCCCGCAGGCGCTATGCAACCGGATCCGCGAGCTGGCGACGCAGGACGTGATCAAG
GGCCTGCCGGCCGGGACGGCGAACCTGCTGGCCTACAACGGGAACGAGCAGGACGGGGAGGAGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail