Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11092
Gene name
LocationContig_96:38285..38958
Strand-
Gene length (bp)673
Transcript length (bp)453
Coding sequence length (bp)453
Protein length (aa) 151

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08570 DUF1761 Protein of unknown function (DUF1761) 2.0E-27 13 139

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UTI9|YKZ2_SCHPO UPF0591 membrane protein C15E1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC15E1.02c PE=3 SV=1 2 145 7.0E-24

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 58 80 22
3 90 112 22
4 121 143 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11092
MSLHYLPPVKPSAIALGTVFNHGVELAVLSPVFGQTYQRAKQANTKEEFLRSREASGAAAAWGTSFLGAALQSYS
VGALINATGTLSYKGAAYLGGLVFAATSVPTYLAQIFTEKRPLDTVGVSVAAKLVETVGLSLFLTWWGTRTNPFD
*
Coding >Hirsu2|11092
ATGTCTCTGCACTACCTCCCGCCCGTCAAGCCGTCGGCGATTGCGCTCGGGACCGTCTTCAACCACGGCGTCGAG
CTGGCCGTGCTGTCGCCCGTCTTCGGCCAGACGTACCAGCGCGCCAAGCAGGCCAACACCAAGGAGGAGTTCCTG
CGCTCGCGCGAGGCCAGCGGCGCCGCCGCCGCCTGGGGCACCTCGTTCCTCGGCGCCGCCCTGCAGAGCTACAGC
GTCGGCGCCCTCATCAATGCCACGGGCACCCTCAGCTACAAGGGTGCCGCCTACCTGGGCGGCCTCGTCTTCGCC
GCCACCTCCGTCCCCACCTATCTCGCGCAAATCTTCACGGAGAAGAGGCCGCTCGACACCGTCGGCGTCAGCGTC
GCCGCCAAGCTCGTCGAGACCGTCGGCCTCTCGCTCTTCCTCACCTGGTGGGGGACGCGCACCAACCCCTTCGAC
TAG
Transcript >Hirsu2|11092
ATGTCTCTGCACTACCTCCCGCCCGTCAAGCCGTCGGCGATTGCGCTCGGGACCGTCTTCAACCACGGCGTCGAG
CTGGCCGTGCTGTCGCCCGTCTTCGGCCAGACGTACCAGCGCGCCAAGCAGGCCAACACCAAGGAGGAGTTCCTG
CGCTCGCGCGAGGCCAGCGGCGCCGCCGCCGCCTGGGGCACCTCGTTCCTCGGCGCCGCCCTGCAGAGCTACAGC
GTCGGCGCCCTCATCAATGCCACGGGCACCCTCAGCTACAAGGGTGCCGCCTACCTGGGCGGCCTCGTCTTCGCC
GCCACCTCCGTCCCCACCTATCTCGCGCAAATCTTCACGGAGAAGAGGCCGCTCGACACCGTCGGCGTCAGCGTC
GCCGCCAAGCTCGTCGAGACCGTCGGCCTCTCGCTCTTCCTCACCTGGTGGGGGACGCGCACCAACCCCTTCGAC
TAG
Gene >Hirsu2|11092
ATGTCTCTGCACTGTAAGAGGCCCGTCGTTCGCCCGAGCATGCCGCGCCGGCGCTGACCGTCCCCAGACCTCCCG
CCCGTCAAGCCGTCGGCGATTGCGCTCGGGACCGTCTTCAACCACGGCGTCGAGCTGGCCGTGCTGTCGCCCGTC
TTCGGCCAGACGTACCAGCGCGCCAAGCAGGCCAACACCAAGGAGGAGTTCCTGCGCTCGCGCGAGGCCAGCGGC
GCCGCCGCCGCCTGGGGCACCTCGTTCCTCGGCGCCGCCCTGCAGAGCTACAGCGTCGGCGCCCTCATCAATGCC
ACGGGCACCCTCAGCTACAAGGGTGCCGCCTACCTGGGCGGCCTCGTCTTCGCCGCCACCTCCGTCCCCACCGTG
CGTCTCGTCCCCTCGCCCTCTCCGTCTCTCTCTCTCTCTCTCTCTCTGTCACTGTCTCTCTCTCCGTCTCTGTCT
CCCCTCTCCGTCTCTGTCTCTCTCTCTGTAGGTTGTTGTGCTTCTTGTTTCCTTGCTGACTGACCTCCCTTCCCC
CCCTCGCCGGCAGTATCTCGCGCAAATCTTCACGGAGAAGAGGCCGCTCGACACCGTCGGCGTCAGCGTCGCCGC
CAAGCTCGTCGAGACCGTCGGCCTCTCGCTCTTCCTCACCTGGTGGGGGACGCGCACCAACCCCTTCGACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail