Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11090
Gene name
LocationContig_96:35495..36219
Strand+
Gene length (bp)724
Transcript length (bp)315
Coding sequence length (bp)315
Protein length (aa) 105

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02939 UcrQ UcrQ family 6.2E-35 24 99

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P48503|QCR8_NEUCR Cytochrome b-c1 complex subunit 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qcr-8 PE=1 SV=1 1 104 4.0E-41
sp|P08525|QCR8_YEAST Cytochrome b-c1 complex subunit 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR8 PE=1 SV=2 20 100 1.0E-16
sp|P49346|QCR8_KLULA Cytochrome b-c1 complex subunit 8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=QCR8 PE=3 SV=1 20 100 7.0E-16
sp|P50523|QCR8_SCHPO Cytochrome b-c1 complex subunit 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr8 PE=3 SV=1 20 97 2.0E-15

GO

GO Term Description Terminal node
GO:0008121 ubiquinol-cytochrome-c reductase activity Yes
GO:0016679 oxidoreductase activity, acting on diphenols and related substances as donors No
GO:0016491 oxidoreductase activity No
GO:0016681 oxidoreductase activity, acting on diphenols and related substances as donors, cytochrome as acceptor No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0009055 electron transfer activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 67 84 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11090
MRPTQALYGGGAPNWKIGHFIGDWGSIGGAKQKGIITYGVSANRLNPFAGIVHDAVFNTFRRTKGQIFYWLPSVM
LGYYLMNWASERNEYLNSKAGRAEFADAE*
Coding >Hirsu2|11090
ATGAGACCGACGCAAGCTCTGTACGGCGGCGGCGCGCCCAACTGGAAAATCGGCCATTTCATTGGCGATTGGGGC
TCAATCGGCGGCGCCAAGCAAAAGGGTATCATCACGTACGGCGTCTCGGCCAACCGACTCAACCCGTTTGCCGGC
ATTGTGCACGACGCCGTCTTCAACACCTTCCGCCGCACCAAGGGCCAGATCTTCTACTGGCTGCCTTCCGTCATG
CTCGGCTACTACCTCATGAACTGGGCCTCTGAACGCAACGAGTACCTGAACTCCAAGGCGGGCCGCGCCGAGTTC
GCCGACGCGGAGTAA
Transcript >Hirsu2|11090
ATGAGACCGACGCAAGCTCTGTACGGCGGCGGCGCGCCCAACTGGAAAATCGGCCATTTCATTGGCGATTGGGGC
TCAATCGGCGGCGCCAAGCAAAAGGGTATCATCACGTACGGCGTCTCGGCCAACCGACTCAACCCGTTTGCCGGC
ATTGTGCACGACGCCGTCTTCAACACCTTCCGCCGCACCAAGGGCCAGATCTTCTACTGGCTGCCTTCCGTCATG
CTCGGCTACTACCTCATGAACTGGGCCTCTGAACGCAACGAGTACCTGAACTCCAAGGCGGGCCGCGCCGAGTTC
GCCGACGCGGAGTAA
Gene >Hirsu2|11090
ATGAGACCGACGCAAGCTCTGTACGGCGGCGGCGCGCCCAACTGGAAAATCGGCCAGTTCGTGTTCCCCTGCGCC
CGCCCGAGGCTGCAACCCGAGGCCGCGGCCTGTCATCGGATGGCCTCGGGTGGCATCTCGGGACCCTTTTTTTTT
CTTGGACTCTGCTTGGAACTGCGTTGGAAGTTACGGAAGCTGACAGAGGCCGGTATAGTTTCATTGGCGATTGGG
GCTCAATCGGTTAGTCCTCCTGTTCCTTTCGCTCGAGTGCCTGCTGCGCGGTCAAGGAGGGCGGACCGGCCCCAA
GCTGGCAGGCCGCTCCATCCGCACCCGCCGGGCCCGTCGACGAGGTCCCGAAGCGAATCGAGCCGGACGACGACG
CATTCCGCGGCAGCGTTTGGGGAGTGGACGGAGGCGTGCTGACGGGCCGCAGGCGGCGCCAAGCAAAAGGGTATC
ATCACGTACGGCGTCTCGGCCAACCGACTCAACCCGTTTGCCGGCATTGTGCACGACGCCGTCTTCAACACCTTC
CGCCGCACCAAGGGCCAGATCTTCTACTGGCTGCCTTCCGTCATGCTCGGCTACTACCTCATGAACTGGGCCTCT
GAACGGTAGGATCCAACCCTGGCCCCCGGAGGAGGTGAGGACGCGGTCGATGGCTGACGTTTTTGCCAGCAACGA
GTACCTGAACTCCAAGGCGGGCCGCGCCGAGTTCGCCGACGCGGAGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail