Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1109
Gene name
LocationContig_1232:2544..3529
Strand-
Gene length (bp)985
Transcript length (bp)795
Coding sequence length (bp)795
Protein length (aa) 265

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 3.7E-10 90 213

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P45797|GUB_PAEPO Beta-glucanase OS=Paenibacillus polymyxa GN=gluB PE=3 SV=1 84 228 5.0E-06

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1109
MHLLRWSLVFAPRLVASLCAVETDFTKTGDVLDERDWVRQQFNVSAKAGRGRYGKTFSVSNISPHGSARLGVAEQ
GIELRVNGAPKNDAVPGAEMDSARVDMHWGSYRAGLKLTAVRGTCAAFFWYFNDTQEIDMEFLSQLYDAGRQLYP
VNLVVQSRKSMEAGYDASRTETFRRVNLSFDPTAGFHEYRFDYLPGRVVFYADSVKLAVMQGEEIPTNGGHLILQ
HWSNGDPMWSGGPPTQDALLLVSYVKAYFNSSQEDGSGQ*
Coding >Hirsu2|1109
ATGCATTTGCTTCGCTGGTCACTGGTGTTTGCCCCGCGCCTCGTGGCGTCGCTCTGCGCGGTCGAAACCGACTTC
ACCAAGACGGGAGATGTCCTGGACGAGCGAGATTGGGTTCGCCAGCAGTTCAACGTCTCGGCCAAGGCTGGCCGT
GGAAGGTATGGCAAGACGTTCAGCGTCAGTAACATATCGCCCCATGGTTCGGCACGGCTTGGCGTGGCCGAACAG
GGAATTGAGCTGCGTGTCAACGGCGCTCCCAAGAACGATGCGGTGCCGGGGGCCGAGATGGATTCTGCGAGGGTG
GACATGCACTGGGGATCGTATCGTGCCGGACTGAAACTGACAGCAGTCCGCGGCACATGCGCTGCCTTCTTCTGG
TACTTCAACGACACGCAAGAGATCGACATGGAATTTCTTTCCCAGCTCTATGATGCCGGCCGTCAACTTTACCCG
GTCAACCTGGTGGTGCAGTCGAGGAAGTCCATGGAGGCCGGGTACGATGCCAGCAGAACGGAGACATTCAGACGC
GTCAACCTCTCATTTGATCCGACAGCCGGCTTCCACGAGTACCGATTCGACTACTTGCCAGGCCGCGTCGTCTTT
TATGCCGACAGCGTCAAGCTGGCCGTGATGCAGGGCGAGGAGATTCCCACGAACGGTGGCCATCTCATTCTCCAG
CACTGGAGCAACGGAGATCCAATGTGGTCAGGCGGCCCCCCGACACAGGACGCGCTGCTCCTCGTCAGTTATGTC
AAGGCTTACTTCAACTCATCCCAAGAGGACGGCTCGGGCCAGTAA
Transcript >Hirsu2|1109
ATGCATTTGCTTCGCTGGTCACTGGTGTTTGCCCCGCGCCTCGTGGCGTCGCTCTGCGCGGTCGAAACCGACTTC
ACCAAGACGGGAGATGTCCTGGACGAGCGAGATTGGGTTCGCCAGCAGTTCAACGTCTCGGCCAAGGCTGGCCGT
GGAAGGTATGGCAAGACGTTCAGCGTCAGTAACATATCGCCCCATGGTTCGGCACGGCTTGGCGTGGCCGAACAG
GGAATTGAGCTGCGTGTCAACGGCGCTCCCAAGAACGATGCGGTGCCGGGGGCCGAGATGGATTCTGCGAGGGTG
GACATGCACTGGGGATCGTATCGTGCCGGACTGAAACTGACAGCAGTCCGCGGCACATGCGCTGCCTTCTTCTGG
TACTTCAACGACACGCAAGAGATCGACATGGAATTTCTTTCCCAGCTCTATGATGCCGGCCGTCAACTTTACCCG
GTCAACCTGGTGGTGCAGTCGAGGAAGTCCATGGAGGCCGGGTACGATGCCAGCAGAACGGAGACATTCAGACGC
GTCAACCTCTCATTTGATCCGACAGCCGGCTTCCACGAGTACCGATTCGACTACTTGCCAGGCCGCGTCGTCTTT
TATGCCGACAGCGTCAAGCTGGCCGTGATGCAGGGCGAGGAGATTCCCACGAACGGTGGCCATCTCATTCTCCAG
CACTGGAGCAACGGAGATCCAATGTGGTCAGGCGGCCCCCCGACACAGGACGCGCTGCTCCTCGTCAGTTATGTC
AAGGCTTACTTCAACTCATCCCAAGAGGACGGCTCGGGCCAGTAA
Gene >Hirsu2|1109
ATGCATTTGCTTCGCTGGTCACTGGTGTTTGCCCCGCGCCTCGTGGCGTCGCTCTGTGAGTGCGGGTTCGCGGTA
GCATCACAAGGAGCGCGCGAAGGGGATAGTCCATTGCTGTTCACAGGCGCGGTCGAAACCGACTTCACCAAGACG
GGAGATGTCCTGGACGAGCGAGATTGGGTTCGCCAGCAGTTCAACGTCTCGGCCAAGGCTGGCCGTGGAAGGTAT
GGCAAGACGTTCAGCGTCAGTAACATATCGCCCCATGGTTCGGCACGGCTTGGCGTGGCCGAACAGGGAATTGAG
CTGCGTGTCAACGGCGCTCCCAAGAACGATGCGGTGCCGGGGGCCGAGATGGATTCTGCGAGGGTGGACATGCAC
TGGGGATCGTATCGTGCCGGACTGAAACTGACAGCAGTCCGCGGCACATGCGCTGCCTTCTTCTGGGTGCGTGCT
CCGCGCCTTTTTGAGTCTTGCTCCGACCAGTCCTGACGTTGGACGGCCTCTAGTACTTCAACGACACGCAAGAGA
TCGACATGGAATTTCTTTCCCAGCTCTATGATGCCGGCCGTCAACTTTACCCGGTCAACCTGGTGGTGCAGTCGA
GGAAGTCCATGGAGGCCGGGTACGATGCCAGCAGAACGGAGACATTCAGACGCGTCAACCTCTCATTTGATCCGA
CAGCCGGCTTCCACGAGTACCGATTCGACTACTTGCCAGGCCGCGTCGTCTTTTATGCCGACAGCGTCAAGCTGG
CCGTGATGCAGGGCGAGGAGATTCCCACGAACGGTGGCCATCTCATTCTCCAGCACTGGAGCAACGGAGATCCAA
TGTGGTCAGGCGGCCCCCCGACACAGGACGCGCTGCTCCTCGTCAGTTATGTCAAGGCTTACTTCAACTCATCCC
AAGAGGACGGCTCGGGGTGGGCGGAACGTTGCATGGGCGCTCAAAGAACGGCCGTGTGCAACATCGCAGACGTCA
TAGCCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail