Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11082
Gene name
LocationContig_96:12972..13336
Strand-
Gene length (bp)364
Transcript length (bp)312
Coding sequence length (bp)312
Protein length (aa) 104

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.4884 0.2666 0.2205 0.1749 0.3451 0.0244 0.1962 0.5136 0.6519 0.0351

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895
Ophiocordyceps australis 1348a (Ghana) OphauG2|266
Ophiocordyceps australis map64 (Brazil) OphauB2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012
Ophiocordyceps australis map64 (Brazil) OphauB2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|4564
Ophiocordyceps australis map64 (Brazil) OphauB2|7299
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000
Ophiocordyceps subramaniannii Hirsu2|8115
Ophiocordyceps subramaniannii Hirsu2|7926
Ophiocordyceps subramaniannii Hirsu2|6259
Ophiocordyceps subramaniannii Hirsu2|2878
Ophiocordyceps subramaniannii Hirsu2|1201
Ophiocordyceps subramaniannii Hirsu2|11082 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11082
LRDLSLELATRTDIYRRFEQVNLELPVSRVAKDLRLCQVGAAPLLTRWSPSSLSVFPFDQQLGAAADPDGLVALV
DVGGGFGHQCLRLPAAFPQLQDRLVLHD*
Coding >Hirsu2|11082
CTGCGCGACCTGAGCCTCGAGCTGGCCACGCGCACCGACATCTACCGTCGCTTCGAGCAGGTGAACCTCGAGCTG
CCCGTCTCGCGCGTCGCCAAGGACTTGCGTCTCTGCCAGGTCGGCGCCGCGCCGCTCCTCACCCGTTGGTCCCCG
TCCTCTCTCTCTGTCTTCCCCTTCGACCAGCAGCTGGGCGCCGCCGCCGACCCGGACGGGCTCGTCGCCCTCGTA
GACGTCGGCGGCGGCTTCGGCCACCAGTGTCTACGGCTACCGGCCGCCTTCCCTCAGCTCCAGGACCGGCTTGTG
CTGCACGACTAG
Transcript >Hirsu2|11082
CTGCGCGACCTGAGCCTCGAGCTGGCCACGCGCACCGACATCTACCGTCGCTTCGAGCAGGTGAACCTCGAGCTG
CCCGTCTCGCGCGTCGCCAAGGACTTGCGTCTCTGCCAGGTCGGCGCCGCGCCGCTCCTCACCCGTTGGTCCCCG
TCCTCTCTCTCTGTCTTCCCCTTCGACCAGCAGCTGGGCGCCGCCGCCGACCCGGACGGGCTCGTCGCCCTCGTA
GACGTCGGCGGCGGCTTCGGCCACCAGTGTCTACGGCTACCGGCCGCCTTCCCTCAGCTCCAGGACCGGCTTGTG
CTGCACGACTAG
Gene >Hirsu2|11082
CTGCGCGACCTGAGCCTCGAGCTGGCCACGCGCACCGACATCTACCGTCGCTTCGAGCAGGTGAACCTCGAGCTG
CCCGTCTCGCGCGTCGCCAAGGACTTGCGTCTCTGCCAGGTCCTGGCCGAGAGCGAGTAGCCGCTGAACCCTCGC
CGAGCTGTCGGCCGAGGTCGGCGCCGCGCCGCTCCTCACCCGTTGGTCCCCGTCCTCTCTCTCTGTCTTCCCCTT
CGACCAGCAGCTGGGCGCCGCCGCCGACCCGGACGGGCTCGTCGCCCTCGTAGACGTCGGCGGCGGCTTCGGCCA
CCAGTGTCTACGGCTACCGGCCGCCTTCCCTCAGCTCCAGGACCGGCTTGTGCTGCACGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail