Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11081
Gene name
LocationContig_96:10563..12104
Strand-
Gene length (bp)1541
Transcript length (bp)1407
Coding sequence length (bp)1407
Protein length (aa) 469

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05057 DUF676 Putative serine esterase (DUF676) 1.1E-48 20 219

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08448|YO059_YEAST Putative lipase YOR059C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR059C PE=1 SV=1 23 445 8.0E-34
sp|O14162|YE7A_SCHPO Putative lipase C4A8.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.10 PE=3 SV=2 14 242 2.0E-13
sp|Q12103|YD109_YEAST Putative lipase YDL109C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL109C PE=1 SV=1 23 222 5.0E-09
sp|P53118|ROG1_YEAST Putative lipase ROG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROG1 PE=1 SV=1 23 222 4.0E-08
sp|Q5RA75|F135A_PONAB Protein FAM135A OS=Pongo abelii GN=FAM135A PE=2 SV=1 13 142 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08448|YO059_YEAST Putative lipase YOR059C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR059C PE=1 SV=1 23 445 8.0E-34
sp|O14162|YE7A_SCHPO Putative lipase C4A8.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.10 PE=3 SV=2 14 242 2.0E-13
sp|Q12103|YD109_YEAST Putative lipase YDL109C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL109C PE=1 SV=1 23 222 5.0E-09
sp|P53118|ROG1_YEAST Putative lipase ROG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROG1 PE=1 SV=1 23 222 4.0E-08
sp|Q5RA75|F135A_PONAB Protein FAM135A OS=Pongo abelii GN=FAM135A PE=2 SV=1 13 142 1.0E-06
sp|Q9P2D6|F135A_HUMAN Protein FAM135A OS=Homo sapiens GN=FAM135A PE=1 SV=2 17 141 4.0E-06
sp|Q6NS59|F135A_MOUSE Protein FAM135A OS=Mus musculus GN=Fam135a PE=1 SV=2 2 141 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

Domain # Start End Length
1 290 312 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11081
MSRPDSESDKADEYGGGSPDADHLCVLVHGLWGNPGHMRNVARALRARHAPDALYLLLARRNSGSFTYDGIELGG
ERVCAEIEDELRAIERRGGRITKLSIVGYSLGGLVSRYAVGLLHAKGVLDRLECMTFATFASPHLGVRSPLKGWH
NHVWNVVGARTLSTSGRQLFTIDKFRDTDRPLLSILADPASIFMRGLRRFRRHTLYTNVVNDRSAVYYTTGIQKT
DPYGRGVDGLRPNYLEGYGGVILDPETPLAPRPAGKGLDLGAGSPGAGRLGSVTASALLWSKRLPLMLVVALLVP
VGTVAFLCNSVVQTVRSSGRIRRHETVDEYRVPLLMDELRGEVERAYGALNSAQDQQFLTAEDDDDDDDDDDDDD
DKLDRSSSPLRPEARRLMSRERRLSLPTQPTLALTPDQFAMIQALDSLAWRKYPVWIHNDRHSHAAIIVRWDKKS
FDEGHTVLRHFAEDEFLV*
Coding >Hirsu2|11081
ATGTCCAGGCCGGACTCGGAGTCGGACAAGGCCGACGAATATGGCGGCGGCAGCCCCGACGCCGACCACCTCTGC
GTCCTTGTGCACGGGCTCTGGGGGAACCCGGGCCACATGAGGAACGTCGCCCGGGCGCTGCGAGCGCGCCACGCG
CCCGACGCGCTGTACCTGCTGCTGGCGCGGCGCAACAGCGGCAGCTTCACCTACGACGGCATCGAGCTGGGCGGC
GAGCGCGTCTGCGCCGAGATCGAGGACGAGCTGCGGGCCATCGAGCGGCGCGGCGGCCGGATCACGAAGCTGAGC
ATCGTCGGCTACTCGCTCGGCGGCCTGGTCTCGCGCTACGCCGTCGGCCTGCTGCACGCCAAGGGGGTGCTGGAC
CGGTTGGAGTGCATGACGTTCGCGACCTTTGCGTCGCCTCACCTCGGCGTCCGCTCGCCGCTCAAGGGCTGGCAC
AATCATGTGTGGAACGTGGTGGGCGCCCGCACGCTGTCGACCTCGGGCCGCCAGCTCTTCACCATCGACAAGTTC
CGCGACACGGACCGGCCGCTGCTGTCCATCCTGGCCGACCCGGCCTCCATCTTCATGCGCGGCCTGCGTCGCTTC
CGGCGCCACACGCTCTACACCAACGTCGTCAACGACCGGAGCGCCGTCTACTACACCACCGGCATCCAGAAGACG
GACCCGTACGGGCGCGGCGTCGACGGCCTCAGGCCAAACTACCTCGAGGGCTACGGGGGCGTCATCCTCGACCCG
GAGACGCCCCTGGCGCCCCGGCCTGCCGGCAAGGGCCTCGACCTCGGCGCCGGTAGCCCCGGCGCCGGCCGCTTG
GGCTCGGTCACGGCCAGCGCCCTGCTGTGGTCGAAGCGCCTCCCCCTCATGCTCGTCGTCGCGCTGCTGGTCCCC
GTCGGCACCGTCGCCTTCCTGTGCAACTCGGTGGTCCAGACGGTCCGCAGCTCCGGCCGCATCAGGCGCCACGAG
ACCGTCGACGAATACCGCGTGCCGCTGCTGATGGACGAGCTGCGCGGTGAGGTCGAGCGGGCGTACGGGGCCCTC
AACAGCGCGCAGGACCAGCAGTTCCTGACGGCCGAGGACGACGACGACGATGACGACGACGACGACGACGACGAC
GACAAGCTCGACCGCTCCTCTTCTCCCTTGAGACCCGAGGCGCGCAGGCTGATGAGCCGCGAGAGGAGGCTGTCG
CTGCCGACGCAGCCGACGCTGGCCCTGACGCCGGACCAGTTCGCCATGATCCAGGCGCTGGACTCGCTCGCGTGG
CGCAAGTATCCCGTCTGGATCCACAACGACCGCCACAGCCACGCGGCCATCATCGTGCGGTGGGACAAGAAGTCC
TTCGACGAGGGCCACACCGTCCTGAGGCACTTTGCCGAGGATGAGTTCCTGGTGTAG
Transcript >Hirsu2|11081
ATGTCCAGGCCGGACTCGGAGTCGGACAAGGCCGACGAATATGGCGGCGGCAGCCCCGACGCCGACCACCTCTGC
GTCCTTGTGCACGGGCTCTGGGGGAACCCGGGCCACATGAGGAACGTCGCCCGGGCGCTGCGAGCGCGCCACGCG
CCCGACGCGCTGTACCTGCTGCTGGCGCGGCGCAACAGCGGCAGCTTCACCTACGACGGCATCGAGCTGGGCGGC
GAGCGCGTCTGCGCCGAGATCGAGGACGAGCTGCGGGCCATCGAGCGGCGCGGCGGCCGGATCACGAAGCTGAGC
ATCGTCGGCTACTCGCTCGGCGGCCTGGTCTCGCGCTACGCCGTCGGCCTGCTGCACGCCAAGGGGGTGCTGGAC
CGGTTGGAGTGCATGACGTTCGCGACCTTTGCGTCGCCTCACCTCGGCGTCCGCTCGCCGCTCAAGGGCTGGCAC
AATCATGTGTGGAACGTGGTGGGCGCCCGCACGCTGTCGACCTCGGGCCGCCAGCTCTTCACCATCGACAAGTTC
CGCGACACGGACCGGCCGCTGCTGTCCATCCTGGCCGACCCGGCCTCCATCTTCATGCGCGGCCTGCGTCGCTTC
CGGCGCCACACGCTCTACACCAACGTCGTCAACGACCGGAGCGCCGTCTACTACACCACCGGCATCCAGAAGACG
GACCCGTACGGGCGCGGCGTCGACGGCCTCAGGCCAAACTACCTCGAGGGCTACGGGGGCGTCATCCTCGACCCG
GAGACGCCCCTGGCGCCCCGGCCTGCCGGCAAGGGCCTCGACCTCGGCGCCGGTAGCCCCGGCGCCGGCCGCTTG
GGCTCGGTCACGGCCAGCGCCCTGCTGTGGTCGAAGCGCCTCCCCCTCATGCTCGTCGTCGCGCTGCTGGTCCCC
GTCGGCACCGTCGCCTTCCTGTGCAACTCGGTGGTCCAGACGGTCCGCAGCTCCGGCCGCATCAGGCGCCACGAG
ACCGTCGACGAATACCGCGTGCCGCTGCTGATGGACGAGCTGCGCGGTGAGGTCGAGCGGGCGTACGGGGCCCTC
AACAGCGCGCAGGACCAGCAGTTCCTGACGGCCGAGGACGACGACGACGATGACGACGACGACGACGACGACGAC
GACAAGCTCGACCGCTCCTCTTCTCCCTTGAGACCCGAGGCGCGCAGGCTGATGAGCCGCGAGAGGAGGCTGTCG
CTGCCGACGCAGCCGACGCTGGCCCTGACGCCGGACCAGTTCGCCATGATCCAGGCGCTGGACTCGCTCGCGTGG
CGCAAGTATCCCGTCTGGATCCACAACGACCGCCACAGCCACGCGGCCATCATCGTGCGGTGGGACAAGAAGTCC
TTCGACGAGGGCCACACCGTCCTGAGGCACTTTGCCGAGGATGAGTTCCTGGTGTAG
Gene >Hirsu2|11081
ATGTCCAGGCCGGACTCGGAGTCGGACAAGGCCGACGAATATGGCGGCGGCAGCCCCGACGCCGACCACCTCTGC
GTCCTTGTGCACGGGGTAAGCAGCCGGCGGCCGGAGAGGCGAGGCAGCGGCGCGTCGCTCACGCGTCTCCGGCGC
AGCTCTGGGGGAACCCGGGCCACATGAGGAACGTCGCCCGGGCGCTGCGAGCGCGCCACGCGCCCGACGCGCTGT
ACCTGCTGCTGGCGCGGCGCAACAGCGGCAGCTTCACCTACGACGGCATCGAGCTGGGCGGCGAGCGCGTCTGCG
CCGAGATCGAGGACGAGCTGCGGGCCATCGAGCGGCGCGGCGGCCGGATCACGAAGCTGAGCATCGTCGGCTACT
CGCTCGGCGGCCTGGTCTCGCGCTACGCCGTCGGCCTGCTGCACGCCAAGGGGGTGCTGGACCGGTTGGAGTGCA
TGGTGACTGCTCCCCCCAAACCCCGTCGCGGCGCCTCATCACGGCCGGCCGGACCGCTCGGCTGACGCGGACAGA
CGTTCGCGACCTTTGCGTCGCCTCACCTCGGCGTCCGCTCGCCGCTCAAGGGCTGGCACAATCATGTGTGGAACG
TGGTGGGCGCCCGCACGCTGTCGACCTCGGGCCGCCAGCTCTTCACCATCGACAAGTTCCGCGACACGGACCGGC
CGCTGCTGTCCATCCTGGCCGACCCGGCCTCCATCTTCATGCGCGGCCTGCGTCGCTTCCGGCGCCACACGCTCT
ACACCAACGTCGTCAACGACCGGAGCGCCGTCTACTACACCACCGGCATCCAGAAGACGGACCCGTACGGGCGCG
GCGTCGACGGCCTCAGGCCAAACTACCTCGAGGGCTACGGGGGCGTCATCCTCGACCCGGAGACGCCCCTGGCGC
CCCGGCCTGCCGGCAAGGGCCTCGACCTCGGCGCCGGTAGCCCCGGCGCCGGCCGCTTGGGCTCGGTCACGGCCA
GCGCCCTGCTGTGGTCGAAGCGCCTCCCCCTCATGCTCGTCGTCGCGCTGCTGGTCCCCGTCGGCACCGTCGCCT
TCCTGTGCAACTCGGTGGTCCAGACGGTCCGCAGCTCCGGCCGCATCAGGCGCCACGAGACCGTCGACGAATACC
GCGTGCCGCTGCTGATGGACGAGCTGCGCGGTGAGGTCGAGCGGGCGTACGGGGCCCTCAACAGCGCGCAGGACC
AGCAGTTCCTGACGGCCGAGGACGACGACGACGATGACGACGACGACGACGACGACGACGACAAGCTCGACCGCT
CCTCTTCTCCCTTGAGACCCGAGGCGCGCAGGCTGATGAGCCGCGAGAGGAGGCTGTCGCTGCCGACGCAGCCGA
CGCTGGCCCTGACGCCGGACCAGTTCGCCATGATCCAGGCGCTGGACTCGCTCGCGTGGCGCAAGTATCCCGTCT
GGATCCACAACGACCGCCACAGCCACGCGGCCATCATCGTGCGGTGGGACAAGAAGTCCTTCGACGAGGGCCACA
CCGTCCTGAGGCACTTTGCCGAGGATGAGTTCCTGGTGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail