Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11080
Gene name
LocationContig_96:8589..9279
Strand-
Gene length (bp)690
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04707 PRELI PRELI-like family 1.4E-15 17 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05776|UPS1_YEAST Protein UPS1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UPS1 PE=1 SV=1 1 208 2.0E-17
sp|Q9UT07|UPS1_SCHPO Protein ups1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP8A3.10 PE=3 SV=1 17 149 1.0E-10
sp|Q9Y3B1|PLD3B_HUMAN PRELI domain containing protein 3B OS=Homo sapiens GN=PRELID3B PE=2 SV=2 6 123 3.0E-10
sp|Q4R5S9|PLD3B_MACFA PRELI domain containing protein 3B OS=Macaca fascicularis GN=PRELID3B PE=2 SV=1 6 123 4.0E-10
sp|Q58DB0|PLD3B_BOVIN PRELI domain containing protein 3B OS=Bos taurus GN=PRELID3B PE=2 SV=1 6 123 6.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05776|UPS1_YEAST Protein UPS1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UPS1 PE=1 SV=1 1 208 2.0E-17
sp|Q9UT07|UPS1_SCHPO Protein ups1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP8A3.10 PE=3 SV=1 17 149 1.0E-10
sp|Q9Y3B1|PLD3B_HUMAN PRELI domain containing protein 3B OS=Homo sapiens GN=PRELID3B PE=2 SV=2 6 123 3.0E-10
sp|Q4R5S9|PLD3B_MACFA PRELI domain containing protein 3B OS=Macaca fascicularis GN=PRELID3B PE=2 SV=1 6 123 4.0E-10
sp|Q58DB0|PLD3B_BOVIN PRELI domain containing protein 3B OS=Bos taurus GN=PRELID3B PE=2 SV=1 6 123 6.0E-10
sp|Q54G07|SLMO_DICDI Protein slowmo homolog OS=Dictyostelium discoideum GN=slmo PE=3 SV=1 1 145 1.0E-09
sp|Q6P9U4|PLD3B_RAT PRELI domain containing protein 3B OS=Rattus norvegicus GN=Prelid3b PE=1 SV=1 6 126 2.0E-09
sp|Q9CYY7|PLD3B_MOUSE PRELI domain containing protein 3B OS=Mus musculus GN=Prelid3b PE=1 SV=2 6 126 2.0E-09
sp|Q6TMK8|PLD3B_CRIGR PRELI domain containing protein 3B OS=Cricetulus griseus GN=PRELID3B PE=2 SV=1 6 126 3.0E-09
sp|A5GFX0|PLD3B_PIG PRELI domain containing protein 3B OS=Sus scrofa GN=PRELID3B PE=3 SV=1 6 123 1.0E-08
sp|Q90673|PRLD1_CHICK PRELI domain-containing protein 1, mitochondrial OS=Gallus gallus GN=PRELID1 PE=2 SV=1 14 209 1.0E-07
sp|Q6GM21|PLD3A_XENLA PRELI domain containing protein 3A OS=Xenopus laevis GN=prelid3a PE=2 SV=1 6 165 4.0E-07
sp|Q96N28|PLD3A_HUMAN PRELI domain containing protein 3A OS=Homo sapiens GN=PRELID3A PE=2 SV=1 6 165 1.0E-06
sp|Q8VE85|PLD3A_MOUSE PRELI domain containing protein 3A OS=Mus musculus GN=Prelid3a PE=1 SV=1 6 165 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11080
MVLTHTTAHTYSHPFPTVTLAYFLRYSSPQLNPFASHVLSTDTIASHVDPATQRLHTTRIHLKKSRLPGAVFKLL
PASVTGGGGQGDKASYILETSVVDIKEGWMRTESRNLNFTGVLSVVEKQQFSLPSGAAGSETAVVTSVIFRSRLG
EKLRDKLGSANEDGWLSGLTGGWGARGIQRSIESLASTKTLDQLGKSRDGMRLVLERIRNNGVMGVLESLRRERQ
TQAA*
Coding >Hirsu2|11080
ATGGTTCTCACGCACACGACGGCGCACACCTACTCGCACCCGTTCCCGACCGTCACGCTCGCCTACTTCCTGCGG
TACTCGTCGCCGCAGCTCAACCCGTTCGCGTCGCATGTGCTGAGCACCGACACCATCGCCAGCCACGTCGACCCC
GCCACGCAGCGGCTGCACACGACGCGCATCCACCTCAAGAAGAGCCGCCTGCCGGGGGCCGTCTTCAAGCTGCTG
CCCGCCAGCGTGACGGGCGGCGGCGGCCAGGGCGACAAGGCGTCATACATACTCGAGACGAGCGTGGTGGACATC
AAGGAGGGCTGGATGCGGACCGAGAGCCGCAACCTCAACTTCACCGGCGTCCTGTCCGTCGTCGAGAAGCAGCAG
TTCAGCCTGCCTTCCGGGGCGGCCGGCAGCGAGACGGCCGTCGTCACCTCGGTCATCTTCCGCTCCCGCCTCGGC
GAGAAGCTGCGCGACAAGCTCGGCTCCGCCAACGAGGACGGCTGGCTGTCCGGCCTCACGGGCGGCTGGGGCGCC
AGGGGCATTCAGCGCAGCATCGAGAGCCTGGCCTCGACCAAGACGCTCGACCAGCTCGGCAAGAGCCGCGACGGC
ATGCGCCTCGTTCTCGAGCGCATCCGCAACAACGGCGTCATGGGCGTCCTCGAGAGCCTGCGCCGCGAGCGTCAG
ACGCAGGCGGCGTGA
Transcript >Hirsu2|11080
ATGGTTCTCACGCACACGACGGCGCACACCTACTCGCACCCGTTCCCGACCGTCACGCTCGCCTACTTCCTGCGG
TACTCGTCGCCGCAGCTCAACCCGTTCGCGTCGCATGTGCTGAGCACCGACACCATCGCCAGCCACGTCGACCCC
GCCACGCAGCGGCTGCACACGACGCGCATCCACCTCAAGAAGAGCCGCCTGCCGGGGGCCGTCTTCAAGCTGCTG
CCCGCCAGCGTGACGGGCGGCGGCGGCCAGGGCGACAAGGCGTCATACATACTCGAGACGAGCGTGGTGGACATC
AAGGAGGGCTGGATGCGGACCGAGAGCCGCAACCTCAACTTCACCGGCGTCCTGTCCGTCGTCGAGAAGCAGCAG
TTCAGCCTGCCTTCCGGGGCGGCCGGCAGCGAGACGGCCGTCGTCACCTCGGTCATCTTCCGCTCCCGCCTCGGC
GAGAAGCTGCGCGACAAGCTCGGCTCCGCCAACGAGGACGGCTGGCTGTCCGGCCTCACGGGCGGCTGGGGCGCC
AGGGGCATTCAGCGCAGCATCGAGAGCCTGGCCTCGACCAAGACGCTCGACCAGCTCGGCAAGAGCCGCGACGGC
ATGCGCCTCGTTCTCGAGCGCATCCGCAACAACGGCGTCATGGGCGTCCTCGAGAGCCTGCGCCGCGAGCGTCAG
ACGCAGGCGGCGTGA
Gene >Hirsu2|11080
ATGGTTCTCACGCACACGACGGCGCACACCTACTCGCACCCGTTCCCGACCGTCACGCTCGCCTACTTCCTGCGG
TACTCGTCGCCGCAGCTCAACCCGTTCGCGTCGCATGTGCTGAGCACCGACACCATCGCCAGCCACGTCGACCCC
GCCACGCAGCGGCTGCACACGACGCGCATCCACCTCAAGAAGAGCCGCCTGCCGGGGGCCGTCTTCAAGCTGCTG
CCCGCCAGCGTGACGGGCGGCGGCGGCCAGGGCGACAAGGCGTCATACATACTCGAGACGAGCGTGGTGGACATC
AAGGAGGGCTGGATGCGGACCGAGAGCCGCAACCTCAACTTCACCGGCGTCCTGTCCGTCGTCGAGAAGCAGCAG
TTCAGCCTGCCTTCCGGGGCGGCCGGCAGCGAGACGGCCGTCGTCACCTCGGTCATCTTCCGCTCCCGCCTCGGC
GAGAAGCTGCGCGACAAGCTCGGCTCCGCCAACGAGGACGGCTGGCTGTCCGGCCTCACGGGCGGCTGGGGCGCC
AGGGGCATTCAGCGCAGCATCGAGAGCCTGGCCTCGACCAAGACGCTCGACCAGCTCGGCAAGAGCCGCGACGGC
ATGCGCCTCGTTCTCGAGCGCATCCGCAACAACGGCGTCATGGGCGTCCTCGAGAGCCTGCGCCGCGAGCGTCAG
ACGCAGGCGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail