Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11072
Gene name
LocationContig_959:5367..6632
Strand-
Gene length (bp)1265
Transcript length (bp)1164
Coding sequence length (bp)1164
Protein length (aa) 388

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.5E-20 83 361
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 5.5E-12 84 360
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.5E-06 80 338

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P80299|HYES_RAT Bifunctional epoxide hydrolase 2 OS=Rattus norvegicus GN=Ephx2 PE=1 SV=1 67 385 5.0E-47
sp|P34914|HYES_MOUSE Bifunctional epoxide hydrolase 2 OS=Mus musculus GN=Ephx2 PE=1 SV=2 67 385 2.0E-46
sp|P34913|HYES_HUMAN Bifunctional epoxide hydrolase 2 OS=Homo sapiens GN=EPHX2 PE=1 SV=2 58 375 1.0E-45
sp|Q6Q2C2|HYES_PIG Bifunctional epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV=1 67 376 2.0E-44
sp|Q8IUS5|EPHX4_HUMAN Epoxide hydrolase 4 OS=Homo sapiens GN=EPHX4 PE=2 SV=2 5 376 9.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P80299|HYES_RAT Bifunctional epoxide hydrolase 2 OS=Rattus norvegicus GN=Ephx2 PE=1 SV=1 67 385 5.0E-47
sp|P34914|HYES_MOUSE Bifunctional epoxide hydrolase 2 OS=Mus musculus GN=Ephx2 PE=1 SV=2 67 385 2.0E-46
sp|P34913|HYES_HUMAN Bifunctional epoxide hydrolase 2 OS=Homo sapiens GN=EPHX2 PE=1 SV=2 58 375 1.0E-45
sp|Q6Q2C2|HYES_PIG Bifunctional epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV=1 67 376 2.0E-44
sp|Q8IUS5|EPHX4_HUMAN Epoxide hydrolase 4 OS=Homo sapiens GN=EPHX4 PE=2 SV=2 5 376 9.0E-23
sp|O31581|YFHM_BACSU AB hydrolase superfamily protein YfhM OS=Bacillus subtilis (strain 168) GN=yfhM PE=3 SV=1 76 385 2.0E-21
sp|Q6IE26|EPHX4_MOUSE Epoxide hydrolase 4 OS=Mus musculus GN=Ephx4 PE=2 SV=2 31 375 8.0E-21
sp|Q0IIS3|EPHX3_XENTR Epoxide hydrolase 3 OS=Xenopus tropicalis GN=ephx3 PE=2 SV=1 37 369 2.0E-19
sp|Q3V1F8|EPHX3_MOUSE Epoxide hydrolase 3 OS=Mus musculus GN=Ephx3 PE=2 SV=2 84 379 1.0E-17
sp|G5EBI4|CEEH1_CAEEL Epoxide hydrolase 1 OS=Caenorhabditis elegans GN=ceeh-1 PE=1 SV=1 84 376 4.0E-15
sp|G5EDL5|CEEH2_CAEEL Epoxide hydrolase 2 OS=Caenorhabditis elegans GN=ceeh-2 PE=1 SV=1 82 184 1.0E-14
sp|Q9H6B9|EPHX3_HUMAN Epoxide hydrolase 3 OS=Homo sapiens GN=EPHX3 PE=2 SV=1 84 380 6.0E-14
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 83 195 2.0E-06
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 83 195 2.0E-06
sp|P66778|EPHD_MYCBO Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 83 195 2.0E-06
sp|Q4R584|ABHD8_MACFA Abhydrolase domain-containing protein 8 OS=Macaca fascicularis GN=ABHD8 PE=2 SV=1 62 182 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11072
MMRYLTSLIVLIPLLASPGALGSPAAADYTPSSRHRPAARCGAMDTSKLVPDDGRVRHCSATVRGRTYKYVVSQP
AARRPIDTIFLIHGFPDLGFGWRYQVPYLTSLGFRVVVPDMLGYAATDSPRDLGPFSLKSLSDDIKELAADIVGD
GQIILGGHDWGGALVWRVALWHPGLLKAVFSICTPFGPPRKDYVSLEDAIAAGQLTNFRYQLQFKGPDVEKAIQG
ETKIRQFLSALHGGLSSDGNKTEAGFTTDRGVIFENLPKIQKPKSMSDQELDFYVQQYMIHDAPQLRGPLNWYRT
AKIDWEEELPLASKNTTLAMPTMFIAATKDAALPPSMSFGMERYMPRLTRGEVDSSHWALTEASHDINKQLGAWL
SGLVNETVKSFM*
Coding >Hirsu2|11072
ATGATGCGCTACCTGACCTCGTTGATCGTTCTGATCCCCCTGCTCGCCTCCCCAGGCGCCCTCGGCTCCCCCGCC
GCGGCCGACTACACGCCGTCGTCCCGGCACCGGCCGGCGGCCCGCTGCGGCGCCATGGACACCAGCAAGCTCGTG
CCCGACGACGGCCGGGTCCGGCACTGCTCGGCCACGGTCCGCGGCCGGACGTACAAGTACGTCGTCAGCCAGCCG
GCGGCCCGGCGGCCCATCGACACCATCTTCCTCATCCACGGCTTCCCCGACCTCGGCTTCGGCTGGCGCTACCAG
GTCCCCTACCTGACCTCGCTGGGCTTCCGCGTCGTCGTGCCGGACATGCTCGGCTACGCCGCCACCGACAGCCCC
CGCGACCTGGGCCCCTTCTCGCTCAAGAGCCTGTCCGACGACATCAAGGAGCTCGCGGCCGACATCGTCGGCGAC
GGCCAGATCATCCTCGGCGGCCACGACTGGGGCGGCGCCCTCGTCTGGCGCGTCGCCCTGTGGCACCCCGGCCTG
CTCAAGGCCGTCTTCAGCATCTGCACCCCCTTCGGCCCGCCGCGCAAGGACTACGTCTCCCTCGAGGATGCCATC
GCCGCCGGCCAGCTGACCAACTTCCGCTACCAGCTGCAGTTCAAGGGCCCCGACGTCGAAAAGGCCATCCAGGGC
GAGACCAAGATCCGCCAGTTCCTCAGCGCCCTCCACGGCGGCCTCAGCTCCGACGGCAACAAGACCGAGGCCGGC
TTCACCACCGACCGCGGCGTCATCTTCGAGAACCTGCCCAAGATACAGAAGCCCAAGAGCATGTCGGACCAGGAG
CTCGACTTCTACGTCCAGCAGTACATGATCCACGACGCCCCGCAGCTACGTGGACCGCTGAACTGGTACCGCACC
GCCAAGATCGACTGGGAGGAGGAGCTCCCTCTGGCGAGCAAGAACACGACGCTCGCCATGCCAACCATGTTTATT
GCCGCCACTAAGGATGCTGCGCTGCCGCCCAGCATGTCGTTCGGCATGGAGAGATACATGCCCAGGTTAACCCGA
GGCGAGGTCGACTCCTCGCACTGGGCGCTTACCGAGGCCAGCCATGATATAAACAAGCAGCTCGGTGCTTGGCTA
AGCGGCCTTGTCAACGAGACTGTCAAGTCCTTCATGTAA
Transcript >Hirsu2|11072
ATGATGCGCTACCTGACCTCGTTGATCGTTCTGATCCCCCTGCTCGCCTCCCCAGGCGCCCTCGGCTCCCCCGCC
GCGGCCGACTACACGCCGTCGTCCCGGCACCGGCCGGCGGCCCGCTGCGGCGCCATGGACACCAGCAAGCTCGTG
CCCGACGACGGCCGGGTCCGGCACTGCTCGGCCACGGTCCGCGGCCGGACGTACAAGTACGTCGTCAGCCAGCCG
GCGGCCCGGCGGCCCATCGACACCATCTTCCTCATCCACGGCTTCCCCGACCTCGGCTTCGGCTGGCGCTACCAG
GTCCCCTACCTGACCTCGCTGGGCTTCCGCGTCGTCGTGCCGGACATGCTCGGCTACGCCGCCACCGACAGCCCC
CGCGACCTGGGCCCCTTCTCGCTCAAGAGCCTGTCCGACGACATCAAGGAGCTCGCGGCCGACATCGTCGGCGAC
GGCCAGATCATCCTCGGCGGCCACGACTGGGGCGGCGCCCTCGTCTGGCGCGTCGCCCTGTGGCACCCCGGCCTG
CTCAAGGCCGTCTTCAGCATCTGCACCCCCTTCGGCCCGCCGCGCAAGGACTACGTCTCCCTCGAGGATGCCATC
GCCGCCGGCCAGCTGACCAACTTCCGCTACCAGCTGCAGTTCAAGGGCCCCGACGTCGAAAAGGCCATCCAGGGC
GAGACCAAGATCCGCCAGTTCCTCAGCGCCCTCCACGGCGGCCTCAGCTCCGACGGCAACAAGACCGAGGCCGGC
TTCACCACCGACCGCGGCGTCATCTTCGAGAACCTGCCCAAGATACAGAAGCCCAAGAGCATGTCGGACCAGGAG
CTCGACTTCTACGTCCAGCAGTACATGATCCACGACGCCCCGCAGCTACGTGGACCGCTGAACTGGTACCGCACC
GCCAAGATCGACTGGGAGGAGGAGCTCCCTCTGGCGAGCAAGAACACGACGCTCGCCATGCCAACCATGTTTATT
GCCGCCACTAAGGATGCTGCGCTGCCGCCCAGCATGTCGTTCGGCATGGAGAGATACATGCCCAGGTTAACCCGA
GGCGAGGTCGACTCCTCGCACTGGGCGCTTACCGAGGCCAGCCATGATATAAACAAGCAGCTCGGTGCTTGGCTA
AGCGGCCTTGTCAACGAGACTGTCAAGTCCTTCATGTAA
Gene >Hirsu2|11072
ATGATGCGCTACCTGACCTCGTTGATCGTTCTGATCCCCCTGCTCGCCTCCCCAGGCGCCCTCGGCTCCCCCGCC
GCGGCCGACTGTGAGTTCCCGGCTCGCCCCGGCCGGCGCGGCCCCGAGACCCGCGCCGGGGCCCCCTCTTCGGCT
TCCGATCTCGTTTTGCCGCTGACGCCGCGCCCGCAGACACGCCGTCGTCCCGGCACCGGCCGGCGGCCCGCTGCG
GCGCCATGGACACCAGCAAGCTCGTGCCCGACGACGGCCGGGTCCGGCACTGCTCGGCCACGGTCCGCGGCCGGA
CGTACAAGTACGTCGTCAGCCAGCCGGCGGCCCGGCGGCCCATCGACACCATCTTCCTCATCCACGGCTTCCCCG
ACCTCGGCTTCGGCTGGCGCTACCAGGTCCCCTACCTGACCTCGCTGGGCTTCCGCGTCGTCGTGCCGGACATGC
TCGGCTACGCCGCCACCGACAGCCCCCGCGACCTGGGCCCCTTCTCGCTCAAGAGCCTGTCCGACGACATCAAGG
AGCTCGCGGCCGACATCGTCGGCGACGGCCAGATCATCCTCGGCGGCCACGACTGGGGCGGCGCCCTCGTCTGGC
GCGTCGCCCTGTGGCACCCCGGCCTGCTCAAGGCCGTCTTCAGCATCTGCACCCCCTTCGGCCCGCCGCGCAAGG
ACTACGTCTCCCTCGAGGATGCCATCGCCGCCGGCCAGCTGACCAACTTCCGCTACCAGCTGCAGTTCAAGGGCC
CCGACGTCGAAAAGGCCATCCAGGGCGAGACCAAGATCCGCCAGTTCCTCAGCGCCCTCCACGGCGGCCTCAGCT
CCGACGGCAACAAGACCGAGGCCGGCTTCACCACCGACCGCGGCGTCATCTTCGAGAACCTGCCCAAGATACAGA
AGCCCAAGAGCATGTCGGACCAGGAGCTCGACTTCTACGTCCAGCAGTACATGATCCACGACGCCCCGCAGCTAC
GTGGACCGCTGAACTGGTACCGCACCGCCAAGATCGACTGGGAGGAGGAGCTCCCTCTGGCGAGCAAGAACACGA
CGCTCGCCATGCCAACCATGTTTATTGCCGCCACTAAGGATGCTGCGCTGCCGCCCAGCATGTCGTTCGGCATGG
AGAGATACATGCCCAGGTTAACCCGAGGCGAGGTCGACTCCTCGCACTGGGCGCTTACCGAGGCCAGCCATGATA
TAAACAAGCAGCTCGGTGCTTGGCTAAGCGGCCTTGTCAACGAGACTGTCAAGTCCTTCATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail