Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11070
Gene name
LocationContig_959:34..3290
Strand-
Gene length (bp)3256
Transcript length (bp)3183
Coding sequence length (bp)3183
Protein length (aa) 1061

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 7.8E-27 237 303
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 8.5E-07 614 898
PF13246 Cation_ATPase Cation transport ATPase (P-type) 3.1E-10 690 786
PF00122 E1-E2_ATPase E1-E2 ATPase 3.7E-07 331 521

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 234 1060 0.0E+00
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 224 1059 0.0E+00
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 235 1060 0.0E+00
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 235 1060 0.0E+00
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 235 1060 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 234 1060 0.0E+00
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 224 1059 0.0E+00
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 235 1060 0.0E+00
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 235 1060 0.0E+00
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 235 1060 0.0E+00
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 235 1059 0.0E+00
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 235 1059 0.0E+00
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 235 1059 0.0E+00
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 235 1060 0.0E+00
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 223 1060 0.0E+00
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 221 1060 0.0E+00
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 235 1060 0.0E+00
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 222 1059 0.0E+00
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 235 1059 0.0E+00
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 226 1057 0.0E+00
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 218 1057 0.0E+00
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 206 1057 0.0E+00
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 233 1059 0.0E+00
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 226 1057 0.0E+00
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 208 1059 0.0E+00
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 206 1059 0.0E+00
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 235 1059 0.0E+00
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 248 1060 0.0E+00
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 248 1060 0.0E+00
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 248 1060 0.0E+00
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 235 1057 0.0E+00
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 196 1059 0.0E+00
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 249 1060 0.0E+00
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 248 1060 0.0E+00
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 229 1059 0.0E+00
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 344 1059 3.0E-179
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 229 1059 1.0E-175
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 344 1059 3.0E-174
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 344 1059 2.0E-161
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 232 1043 2.0E-160
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 232 1057 2.0E-159
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 238 1059 2.0E-157
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 235 1059 2.0E-156
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 238 1059 1.0E-154
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 324 1059 2.0E-153
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 235 1057 7.0E-114
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 178 1057 5.0E-111
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 163 1057 6.0E-110
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 178 1057 1.0E-109
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 178 1057 1.0E-108
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 178 1057 6.0E-108
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 178 1057 3.0E-105
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 234 1057 9.0E-105
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 234 1057 8.0E-104
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 705 1059 6.0E-86
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 705 1059 5.0E-85
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 705 1059 5.0E-85
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 700 1059 1.0E-80
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 698 1059 3.0E-80
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 246 658 5.0E-80
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 696 1059 6.0E-80
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 223 679 6.0E-79
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 252 658 2.0E-77
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 250 663 4.0E-77
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 235 658 7.0E-75
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 351 790 2.0E-72
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 768 1060 3.0E-58
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 777 1060 1.0E-56
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 346 644 4.0E-50
sp|Q2QMX9|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1 589 1043 1.0E-22
sp|Q37145|ACA1_ARATH Calcium-transporting ATPase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=3 589 1043 2.0E-22
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 589 1043 5.0E-21
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 589 1043 2.0E-20
sp|Q6ATV4|ACA2_ORYSJ Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1 589 1043 3.0E-20
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 546 1039 8.0E-20
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 546 1039 8.0E-20
sp|Q9R0K7|AT2B2_MOUSE Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus GN=Atp2b2 PE=1 SV=2 546 1039 1.0E-19
sp|Q64568|AT2B3_RAT Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 504 1039 2.0E-19
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 504 1039 5.0E-19
sp|O81108|ACA2_ARATH Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1 589 1043 2.0E-18
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 589 1043 4.0E-18
sp|Q65X71|ACA6_ORYSJ Probable calcium-transporting ATPase 6, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os05g0495600 PE=3 SV=1 753 1043 2.0E-17
sp|P23634|AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2 546 1039 2.0E-17
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 598 1043 3.0E-17
sp|O34431|ATCL_BACSU Calcium-transporting ATPase OS=Bacillus subtilis (strain 168) GN=yloB PE=1 SV=1 598 1039 6.0E-17
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 546 1039 8.0E-17
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 546 1039 9.0E-17
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 546 1039 1.0E-16
sp|Q6Q477|AT2B4_MOUSE Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus GN=Atp2b4 PE=1 SV=1 546 1039 3.0E-16
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 250 339 4.0E-16
sp|D3K0R6|AT2B4_BOVIN Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 546 1039 5.0E-16
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 683 822 1.0E-15
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 546 1039 2.0E-15
sp|Q64542|AT2B4_RAT Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 546 1039 2.0E-15
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 546 1039 3.0E-15
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 598 1043 8.0E-15
sp|Q2QY12|ACA4_ORYSJ Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1 753 1043 4.0E-14
sp|O23087|ECA2_ARATH Calcium-transporting ATPase 2, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA2 PE=1 SV=1 598 1044 4.0E-14
sp|P54708|AT12A_RAT Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus GN=Atp12a PE=1 SV=1 303 1039 8.0E-14
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 250 340 2.0E-13
sp|Q42883|ECAP_SOLLC Calcium-transporting ATPase, endoplasmic reticulum-type OS=Solanum lycopersicum GN=LCA1 PE=2 SV=1 598 1044 2.0E-13
sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 598 1043 2.0E-13
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 546 1039 3.0E-13
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 598 1043 7.0E-13
sp|Q9TV52|AT12A_RABIT Potassium-transporting ATPase alpha chain 2 OS=Oryctolagus cuniculus GN=ATP12A PE=2 SV=1 268 1039 9.0E-13
sp|P54707|AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens GN=ATP12A PE=1 SV=3 329 1039 1.0E-12
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 744 1036 3.0E-12
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 738 1036 7.0E-12
sp|Q64392|AT12A_CAVPO Potassium-transporting ATPase alpha chain 2 OS=Cavia porcellus GN=ATP12A PE=2 SV=1 345 1039 1.0E-11
sp|P20648|ATP4A_HUMAN Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens GN=ATP4A PE=2 SV=5 298 1039 2.0E-11
sp|Q80XR2|AT2C1_MOUSE Calcium-transporting ATPase type 2C member 1 OS=Mus musculus GN=Atp2c1 PE=1 SV=2 598 1039 2.0E-11
sp|Q9Z1W8|AT12A_MOUSE Potassium-transporting ATPase alpha chain 2 OS=Mus musculus GN=Atp12a PE=1 SV=3 600 1039 2.0E-11
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 325 1039 3.0E-11
sp|Q9XES1|ECA4_ARATH Calcium-transporting ATPase 4, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA4 PE=2 SV=2 598 1044 3.0E-11
sp|Q92036|AT12A_RHIMB Potassium-transporting ATPase alpha chain 2 OS=Rhinella marina GN=ATP12A PE=2 SV=1 606 1039 3.0E-11
sp|Q8Y8Q5|LMCA1_LISMO Calcium-transporting ATPase lmo0841 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0841 PE=1 SV=1 598 1027 4.0E-11
sp|P19156|ATP4A_PIG Potassium-transporting ATPase alpha chain 1 OS=Sus scrofa GN=ATP4A PE=1 SV=3 548 1039 5.0E-11
sp|Q64566|AT2C1_RAT Calcium-transporting ATPase type 2C member 1 OS=Rattus norvegicus GN=Atp2c1 PE=2 SV=1 598 1039 5.0E-11
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 253 341 7.0E-11
sp|Q9CFU9|LLCA1_LACLA Calcium-transporting ATPase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yoaB PE=1 SV=1 306 1043 7.0E-11
sp|Q64436|ATP4A_MOUSE Potassium-transporting ATPase alpha chain 1 OS=Mus musculus GN=Atp4a PE=1 SV=3 331 1039 7.0E-11
sp|O14072|ATC4_SCHPO Manganese-transporting ATPase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta4 PE=3 SV=1 618 1027 8.0E-11
sp|Q5R5K5|AT2C1_PONAB Calcium-transporting ATPase type 2C member 1 OS=Pongo abelii GN=ATP2C1 PE=2 SV=1 598 1039 9.0E-11
sp|Q5ZKB7|AT134_CHICK Probable cation-transporting ATPase 13A4 OS=Gallus gallus GN=ATP13A4 PE=2 SV=1 753 1032 1.0E-10
sp|P09626|ATP4A_RAT Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus GN=Atp4a PE=1 SV=3 548 1039 1.0E-10
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 753 1032 1.0E-10
sp|P98194|AT2C1_HUMAN Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens GN=ATP2C1 PE=1 SV=3 598 1039 1.0E-10
sp|Q9H7F0|AT133_HUMAN Probable cation-transporting ATPase 13A3 OS=Homo sapiens GN=ATP13A3 PE=1 SV=4 727 1036 1.0E-10
sp|P27112|ATP4A_RABIT Potassium-transporting ATPase alpha chain 1 OS=Oryctolagus cuniculus GN=ATP4A PE=2 SV=3 331 1039 1.0E-10
sp|Q4VNC1|AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 753 1032 1.0E-10
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 222 341 2.0E-10
sp|P50996|ATP4A_CANLF Potassium-transporting ATPase alpha chain 1 OS=Canis lupus familiaris GN=ATP4A PE=2 SV=3 548 1039 2.0E-10
sp|P57709|AT2C1_BOVIN Calcium-transporting ATPase type 2C member 1 OS=Bos taurus GN=ATP2C1 PE=2 SV=1 598 1039 2.0E-10
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 600 1032 4.0E-10
sp|P92939|ECA1_ARATH Calcium-transporting ATPase 1, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA1 PE=1 SV=2 598 1044 5.0E-10
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 753 1032 9.0E-10
sp|Q8RUN1|ACA3_ORYSJ Calcium-transporting ATPase 3, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os01g0939100 PE=2 SV=1 598 1043 9.0E-10
sp|P24797|AT1A2_CHICK Sodium/potassium-transporting ATPase subunit alpha-2 OS=Gallus gallus GN=ATP1A2 PE=2 SV=1 268 1039 1.0E-09
sp|P06685|AT1A1_RAT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus GN=Atp1a1 PE=1 SV=1 335 1039 1.0E-09
sp|Q8VDN2|AT1A1_MOUSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus GN=Atp1a1 PE=1 SV=1 335 1039 2.0E-09
sp|Q64578|AT2A1_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Rattus norvegicus GN=Atp2a1 PE=1 SV=1 598 1039 3.0E-09
sp|Q9SY55|ECA3_ARATH Calcium-transporting ATPase 3, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA3 PE=2 SV=3 598 1044 3.0E-09
sp|Q27533|YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans GN=W08D2.5 PE=3 SV=2 725 1036 3.0E-09
sp|P18907|AT1A1_HORSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Equus caballus GN=ATP1A1 PE=3 SV=1 268 1039 3.0E-09
sp|Q6RWA9|AT1A_TAESO Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium PE=2 SV=1 606 1039 4.0E-09
sp|Q92105|AT2A1_PELES Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Pelophylax esculentus GN=ATP2A1 PE=2 SV=1 598 1039 4.0E-09
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 250 357 5.0E-09
sp|P22189|ATC3_SCHPO Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 606 1039 5.0E-09
sp|P06686|AT1A2_RAT Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus GN=Atp1a2 PE=1 SV=1 295 1029 5.0E-09
sp|Q6PIE5|AT1A2_MOUSE Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus GN=Atp1a2 PE=1 SV=1 295 1029 5.0E-09
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 753 1032 5.0E-09
sp|Q8R429|AT2A1_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Mus musculus GN=Atp2a1 PE=1 SV=1 598 1039 6.0E-09
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 228 334 7.0E-09
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 744 1044 2.0E-08
sp|Q12697|YPK9_YEAST Vacuolar cation-transporting ATPase YPK9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK9 PE=1 SV=1 752 1036 2.0E-08
sp|P54209|ATC1_DUNBI Cation-transporting ATPase CA1 OS=Dunaliella bioculata GN=CA1 PE=2 SV=1 598 1027 3.0E-08
sp|Q9YH26|AT1A1_OREMO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oreochromis mossambicus GN=atp1a1 PE=2 SV=2 606 1039 3.0E-08
sp|P13607|ATNA_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster GN=Atpalpha PE=1 SV=3 606 1039 6.0E-08
sp|P05024|AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa GN=ATP1A1 PE=1 SV=1 268 1039 6.0E-08
sp|Q9N0Z6|AT1A1_RABIT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oryctolagus cuniculus GN=ATP1A1 PE=1 SV=2 335 1039 8.0E-08
sp|Q5RDR3|AT1A1_PONAB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Pongo abelii GN=ATP1A1 PE=2 SV=1 468 1039 1.0E-07
sp|P05023|AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1 335 1039 1.0E-07
sp|Q9YGL9|AT2A3_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Gallus gallus GN=ATP2A3 PE=2 SV=1 598 1039 1.0E-07
sp|P25489|AT1A1_CATCO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Catostomus commersonii GN=atp1a1 PE=2 SV=1 606 1039 1.0E-07
sp|P04074|AT1A1_SHEEP Sodium/potassium-transporting ATPase subunit alpha-1 OS=Ovis aries GN=ATP1A1 PE=1 SV=1 268 1039 2.0E-07
sp|Q08DA1|AT1A1_BOVIN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Bos taurus GN=ATP1A1 PE=2 SV=1 268 1039 2.0E-07
sp|P35317|AT1A_HYDVU Sodium/potassium-transporting ATPase subunit alpha OS=Hydra vulgaris PE=2 SV=1 606 1039 4.0E-07
sp|P13637|AT1A3_HUMAN Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens GN=ATP1A3 PE=1 SV=3 468 1039 4.0E-07
sp|P09572|AT1A1_CHICK Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus GN=ATP1A1 PE=2 SV=1 606 1039 6.0E-07
sp|P06687|AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus GN=Atp1a3 PE=1 SV=2 468 1039 6.0E-07
sp|Q6PIC6|AT1A3_MOUSE Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus GN=Atp1a3 PE=1 SV=1 468 1039 6.0E-07
sp|P50997|AT1A1_CANLF Sodium/potassium-transporting ATPase subunit alpha-1 OS=Canis lupus familiaris GN=ATP1A1 PE=2 SV=1 268 1039 7.0E-07
sp|P39986|ATC6_YEAST Manganese-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPF1 PE=1 SV=1 752 1027 1.0E-06
sp|O14022|CTA5_SCHPO Cation-transporting ATPase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta5 PE=3 SV=1 745 1036 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 500 522 22
2 553 575 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11070
MSGRPTGGLHGRPPGQREDLLLDLDGDQPVYGGGQRSALNDDQLLRAHTLEQDAPSRPSVSYDDFVGASGPSAGR
PPGRAGLATGAEQRAGGPYINRPYSQSSDLDHYQRYADDFDDYPADADSFYQHGGGAGAMAGQAHASSSARNNAR
NRNSVLSLGGGLLGRVKNRLGMGEGYSEMDLPLTEPGQERGAAPAGAAGPHDASQRDRRSNKFDMGNFKFGFGKS
KPDPSTLGPRVIHLNNPPANAANKYVDNHISTAKYNFATFLPKFLFEQFSKFANIFFLFTAGLQQIPGLSPTNRY
TTIAPLLIVLLISAGKELVEDYRRKQADNALNTSKARVLRGSTFAETKWINVAVGDVIRVESEEPFPADLVLLAS
SEPEGLCYIETANLDGETNLKIKQALPETSTMVSPSELSRLGGRIKSEQPNSSLYTYEATLTMQAGGGEKELPLN
PEQLLLRGATLRNTPWIHGVVVFTGHETKLMRNATAAPIKRTKVEKQLNWLVLVLVGMLLVLSVICTVGDLVMRS
VRSDSLQYLYLDRINSAGKVVQTFARDMVTYWVLFSSLVPISLFVTVELVKYWHGILINDDLDMYHDKTDTPATC
RTSSLVEELGMVEYVFSDKTGTLTCNQMEFKQCTIAGVQYADEVPEDRRATAHDDADGAIHDFARLKANLAEGHE
TAPAIDHFLSLLAICHTVIPEMNEKGQIKYQAASPDEGALVSGAVELGYRFTARKPKSVIIEAGGRELEFELLAV
CEFNSTRKRMSAIYRCPDGKIRCYCKGADTVILERLNDQNPHVEATLRHLEEYASEGLRTLCLAMREIPEQEFAE
WSQLFEAAATTVGGNRADELDKAAEIIEHDFFLLGATAIEDRLQDGVPETIHTLQQANIKVWVLTGDRQETAINI
GMSCKLLSEDMMLLIVNEESAAATGDNLQKKLDAIRTQADGTIETETLALIIDGKSLTYALEKELEKLFLDLAVM
CKAVICCRVSPLQKALVVKLVKRYQKESILLAIGDGANDVSMIQAAHIGVGISGMEGLQAARSADVAIAQFRYLR
KLLLVHGAFG*
Coding >Hirsu2|11070
ATGTCTGGAAGGCCGACCGGAGGTCTCCATGGCCGACCCCCTGGCCAGCGCGAGGACCTGCTGCTGGACCTGGAC
GGCGACCAGCCCGTCTACGGCGGCGGCCAGCGGTCCGCCCTCAACGACGACCAACTTCTCCGCGCGCACACGCTC
GAACAAGACGCGCCCAGCCGGCCGTCCGTCTCGTACGACGACTTCGTTGGCGCCTCGGGCCCGTCGGCAGGTCGC
CCCCCTGGCCGCGCCGGACTGGCGACGGGCGCCGAACAAAGGGCGGGCGGGCCGTACATAAACAGACCGTACAGC
CAGTCGTCGGACCTGGACCACTACCAGCGATACGCCGACGACTTCGACGACTACCCGGCCGACGCCGACTCGTTT
TACCAGCACGGGGGAGGAGCGGGCGCAATGGCCGGCCAGGCCCACGCGTCGTCGTCGGCGAGGAACAATGCGAGG
AACCGGAATAGCGTCCTGAGCCTCGGCGGCGGCCTCCTGGGCCGCGTCAAGAACCGGCTGGGCATGGGCGAGGGC
TACTCCGAGATGGACCTGCCGCTGACCGAGCCCGGACAGGAGCGAGGGGCGGCCCCGGCCGGCGCCGCCGGCCCG
CACGACGCCTCGCAGCGGGACCGCCGGAGCAACAAGTTCGACATGGGCAACTTCAAGTTCGGCTTCGGCAAGAGC
AAGCCCGACCCGTCGACGCTCGGCCCGCGCGTCATCCACCTCAACAACCCGCCGGCCAACGCGGCCAACAAGTAC
GTCGACAACCACATCTCGACGGCCAAGTACAACTTCGCCACCTTCCTGCCCAAGTTCCTCTTCGAGCAGTTCTCC
AAGTTCGCAAACATCTTCTTCCTCTTCACCGCCGGCCTGCAGCAGATCCCGGGCCTGTCGCCGACGAACCGCTAC
ACCACCATCGCCCCGCTGCTCATCGTCCTCCTCATCTCGGCGGGCAAGGAGCTGGTGGAGGACTACCGGCGCAAG
CAGGCCGACAACGCGCTCAACACGTCCAAGGCCCGCGTCCTGCGCGGCTCCACCTTCGCCGAGACCAAGTGGATC
AACGTGGCGGTCGGGGACGTGATCCGGGTCGAGTCGGAGGAGCCCTTCCCGGCCGACCTGGTGCTGCTCGCCAGT
TCCGAGCCCGAGGGTCTCTGTTATATCGAGACGGCGAACCTGGACGGCGAGACGAACCTCAAGATCAAGCAGGCC
CTGCCCGAGACGTCGACCATGGTCTCGCCCAGCGAGCTCAGCCGGCTCGGCGGCCGCATCAAGTCGGAGCAGCCC
AACAGCAGCCTCTACACCTACGAGGCGACGCTGACGATGCAGGCCGGCGGCGGCGAGAAGGAGCTGCCGCTGAAC
CCGGAGCAGCTCCTGCTGCGGGGCGCGACGCTGAGGAACACGCCGTGGATCCACGGCGTCGTCGTCTTCACCGGC
CACGAGACCAAGCTGATGAGAAACGCGACGGCCGCCCCAATCAAGCGGACCAAGGTGGAGAAGCAGCTCAACTGG
CTGGTCCTGGTGCTCGTCGGCATGCTGCTCGTCCTGAGCGTCATCTGCACCGTCGGCGACCTGGTGATGCGCAGC
GTCCGGAGCGACTCGCTGCAGTACCTCTACCTGGACCGCATCAACAGCGCGGGCAAGGTGGTGCAGACGTTCGCC
CGTGACATGGTCACCTACTGGGTCCTCTTCTCCTCGCTCGTGCCCATCTCGCTCTTCGTCACGGTCGAGCTGGTC
AAGTACTGGCACGGCATCCTCATCAACGACGACCTCGACATGTACCACGACAAGACGGACACGCCCGCCACCTGC
CGCACCTCGAGCCTGGTCGAGGAGCTGGGCATGGTGGAGTACGTCTTCTCCGACAAGACGGGCACGCTGACGTGC
AACCAGATGGAGTTCAAGCAGTGCACCATCGCCGGCGTCCAGTACGCCGACGAGGTGCCCGAGGACCGGCGGGCG
ACGGCGCACGACGACGCCGACGGCGCCATCCACGACTTCGCCCGGCTCAAGGCGAACCTGGCCGAGGGCCACGAG
ACGGCGCCGGCCATCGACCACTTCCTGTCGCTGCTGGCCATCTGCCACACCGTCATCCCCGAGATGAACGAGAAG
GGCCAGATCAAGTACCAGGCCGCGTCGCCGGACGAGGGCGCGCTCGTGTCGGGCGCCGTCGAGCTGGGCTACCGC
TTCACGGCGCGCAAGCCCAAGTCGGTCATCATCGAGGCGGGCGGGCGCGAGCTCGAGTTCGAGCTGCTGGCCGTC
TGCGAGTTCAACTCGACGCGCAAGCGCATGTCGGCCATCTACCGCTGCCCGGACGGCAAGATCCGCTGCTACTGC
AAGGGCGCCGACACGGTCATCCTCGAGCGGCTCAACGACCAGAACCCGCACGTGGAGGCGACGCTGCGGCACCTG
GAGGAGTACGCGTCGGAGGGCCTGCGGACGCTGTGCCTGGCGATGCGCGAGATACCGGAGCAGGAGTTCGCCGAG
TGGAGCCAGCTCTTCGAGGCGGCGGCGACGACGGTCGGCGGCAACCGGGCCGACGAGCTGGACAAGGCGGCCGAG
ATCATCGAGCACGACTTCTTTCTGCTGGGCGCGACGGCCATCGAGGACCGGCTCCAGGACGGGGTGCCCGAGACG
ATCCACACGCTGCAGCAGGCCAACATCAAGGTGTGGGTGCTGACGGGCGACCGGCAGGAGACGGCCATCAACATC
GGCATGAGCTGCAAGCTGCTGAGCGAGGACATGATGCTGCTGATCGTCAACGAGGAGAGCGCGGCGGCGACGGGC
GACAACCTGCAGAAGAAGCTGGACGCGATCCGGACGCAGGCGGACGGGACGATCGAGACGGAGACGCTGGCGCTC
ATCATCGACGGCAAGTCGCTGACGTACGCGCTCGAGAAGGAGCTGGAGAAGCTGTTCCTGGACCTGGCCGTCATG
TGCAAGGCCGTCATCTGCTGCCGGGTGTCGCCGCTGCAGAAGGCGCTGGTGGTGAAGCTGGTGAAGCGGTACCAG
AAGGAGTCGATCCTGCTGGCCATCGGCGACGGGGCCAACGACGTGTCGATGATCCAGGCGGCGCACATCGGGGTC
GGCATCAGCGGCATGGAGGGGCTGCAGGCGGCGCGGAGCGCCGACGTGGCCATCGCGCAGTTCCGGTACCTGCGC
AAGCTGCTGCTGGTGCACGGGGCTTTTGGGTGA
Transcript >Hirsu2|11070
ATGTCTGGAAGGCCGACCGGAGGTCTCCATGGCCGACCCCCTGGCCAGCGCGAGGACCTGCTGCTGGACCTGGAC
GGCGACCAGCCCGTCTACGGCGGCGGCCAGCGGTCCGCCCTCAACGACGACCAACTTCTCCGCGCGCACACGCTC
GAACAAGACGCGCCCAGCCGGCCGTCCGTCTCGTACGACGACTTCGTTGGCGCCTCGGGCCCGTCGGCAGGTCGC
CCCCCTGGCCGCGCCGGACTGGCGACGGGCGCCGAACAAAGGGCGGGCGGGCCGTACATAAACAGACCGTACAGC
CAGTCGTCGGACCTGGACCACTACCAGCGATACGCCGACGACTTCGACGACTACCCGGCCGACGCCGACTCGTTT
TACCAGCACGGGGGAGGAGCGGGCGCAATGGCCGGCCAGGCCCACGCGTCGTCGTCGGCGAGGAACAATGCGAGG
AACCGGAATAGCGTCCTGAGCCTCGGCGGCGGCCTCCTGGGCCGCGTCAAGAACCGGCTGGGCATGGGCGAGGGC
TACTCCGAGATGGACCTGCCGCTGACCGAGCCCGGACAGGAGCGAGGGGCGGCCCCGGCCGGCGCCGCCGGCCCG
CACGACGCCTCGCAGCGGGACCGCCGGAGCAACAAGTTCGACATGGGCAACTTCAAGTTCGGCTTCGGCAAGAGC
AAGCCCGACCCGTCGACGCTCGGCCCGCGCGTCATCCACCTCAACAACCCGCCGGCCAACGCGGCCAACAAGTAC
GTCGACAACCACATCTCGACGGCCAAGTACAACTTCGCCACCTTCCTGCCCAAGTTCCTCTTCGAGCAGTTCTCC
AAGTTCGCAAACATCTTCTTCCTCTTCACCGCCGGCCTGCAGCAGATCCCGGGCCTGTCGCCGACGAACCGCTAC
ACCACCATCGCCCCGCTGCTCATCGTCCTCCTCATCTCGGCGGGCAAGGAGCTGGTGGAGGACTACCGGCGCAAG
CAGGCCGACAACGCGCTCAACACGTCCAAGGCCCGCGTCCTGCGCGGCTCCACCTTCGCCGAGACCAAGTGGATC
AACGTGGCGGTCGGGGACGTGATCCGGGTCGAGTCGGAGGAGCCCTTCCCGGCCGACCTGGTGCTGCTCGCCAGT
TCCGAGCCCGAGGGTCTCTGTTATATCGAGACGGCGAACCTGGACGGCGAGACGAACCTCAAGATCAAGCAGGCC
CTGCCCGAGACGTCGACCATGGTCTCGCCCAGCGAGCTCAGCCGGCTCGGCGGCCGCATCAAGTCGGAGCAGCCC
AACAGCAGCCTCTACACCTACGAGGCGACGCTGACGATGCAGGCCGGCGGCGGCGAGAAGGAGCTGCCGCTGAAC
CCGGAGCAGCTCCTGCTGCGGGGCGCGACGCTGAGGAACACGCCGTGGATCCACGGCGTCGTCGTCTTCACCGGC
CACGAGACCAAGCTGATGAGAAACGCGACGGCCGCCCCAATCAAGCGGACCAAGGTGGAGAAGCAGCTCAACTGG
CTGGTCCTGGTGCTCGTCGGCATGCTGCTCGTCCTGAGCGTCATCTGCACCGTCGGCGACCTGGTGATGCGCAGC
GTCCGGAGCGACTCGCTGCAGTACCTCTACCTGGACCGCATCAACAGCGCGGGCAAGGTGGTGCAGACGTTCGCC
CGTGACATGGTCACCTACTGGGTCCTCTTCTCCTCGCTCGTGCCCATCTCGCTCTTCGTCACGGTCGAGCTGGTC
AAGTACTGGCACGGCATCCTCATCAACGACGACCTCGACATGTACCACGACAAGACGGACACGCCCGCCACCTGC
CGCACCTCGAGCCTGGTCGAGGAGCTGGGCATGGTGGAGTACGTCTTCTCCGACAAGACGGGCACGCTGACGTGC
AACCAGATGGAGTTCAAGCAGTGCACCATCGCCGGCGTCCAGTACGCCGACGAGGTGCCCGAGGACCGGCGGGCG
ACGGCGCACGACGACGCCGACGGCGCCATCCACGACTTCGCCCGGCTCAAGGCGAACCTGGCCGAGGGCCACGAG
ACGGCGCCGGCCATCGACCACTTCCTGTCGCTGCTGGCCATCTGCCACACCGTCATCCCCGAGATGAACGAGAAG
GGCCAGATCAAGTACCAGGCCGCGTCGCCGGACGAGGGCGCGCTCGTGTCGGGCGCCGTCGAGCTGGGCTACCGC
TTCACGGCGCGCAAGCCCAAGTCGGTCATCATCGAGGCGGGCGGGCGCGAGCTCGAGTTCGAGCTGCTGGCCGTC
TGCGAGTTCAACTCGACGCGCAAGCGCATGTCGGCCATCTACCGCTGCCCGGACGGCAAGATCCGCTGCTACTGC
AAGGGCGCCGACACGGTCATCCTCGAGCGGCTCAACGACCAGAACCCGCACGTGGAGGCGACGCTGCGGCACCTG
GAGGAGTACGCGTCGGAGGGCCTGCGGACGCTGTGCCTGGCGATGCGCGAGATACCGGAGCAGGAGTTCGCCGAG
TGGAGCCAGCTCTTCGAGGCGGCGGCGACGACGGTCGGCGGCAACCGGGCCGACGAGCTGGACAAGGCGGCCGAG
ATCATCGAGCACGACTTCTTTCTGCTGGGCGCGACGGCCATCGAGGACCGGCTCCAGGACGGGGTGCCCGAGACG
ATCCACACGCTGCAGCAGGCCAACATCAAGGTGTGGGTGCTGACGGGCGACCGGCAGGAGACGGCCATCAACATC
GGCATGAGCTGCAAGCTGCTGAGCGAGGACATGATGCTGCTGATCGTCAACGAGGAGAGCGCGGCGGCGACGGGC
GACAACCTGCAGAAGAAGCTGGACGCGATCCGGACGCAGGCGGACGGGACGATCGAGACGGAGACGCTGGCGCTC
ATCATCGACGGCAAGTCGCTGACGTACGCGCTCGAGAAGGAGCTGGAGAAGCTGTTCCTGGACCTGGCCGTCATG
TGCAAGGCCGTCATCTGCTGCCGGGTGTCGCCGCTGCAGAAGGCGCTGGTGGTGAAGCTGGTGAAGCGGTACCAG
AAGGAGTCGATCCTGCTGGCCATCGGCGACGGGGCCAACGACGTGTCGATGATCCAGGCGGCGCACATCGGGGTC
GGCATCAGCGGCATGGAGGGGCTGCAGGCGGCGCGGAGCGCCGACGTGGCCATCGCGCAGTTCCGGTACCTGCGC
AAGCTGCTGCTGGTGCACGGGGCTTTTGGGTGA
Gene >Hirsu2|11070
ATGTCTGGAAGGCCGACCGGAGGTCTCCATGGCCGACCCCCTGGCCAGCGCGAGGACCTGCTGCTGGACCTGGAC
GGCGACCAGCCCGTCTACGGCGGCGGCCAGCGGTCCGCCCTCAACGACGACCAACTTCTCCGCGCGCACACGCTC
GAACAAGACGCGCCCAGCCGGCCGTCCGTCTCGTACGACGACTTCGTTGGCGCCTCGGGCCCGTCGGCAGGTCGC
CCCCCTGGCCGCGCCGGACTGGCGACGGGCGCCGAACAAAGGGCGGGCGGGCCGTACATAAACAGACCGTACAGC
CAGTCGTCGGACCTGGACCACTACCAGCGATACGCCGACGACTTCGACGACTACCCGGCCGACGCCGACTCGTTT
TACCAGCACGGGGGAGGAGCGGGCGCAATGGCCGGCCAGGCCCACGCGTCGTCGTCGGCGAGGAACAATGCGAGG
AACCGGAATAGCGTCCTGAGCCTCGGCGGCGGCCTCCTGGGCCGCGTCAAGAACCGGCTGGGCATGGGCGAGGGC
TACTCCGAGATGGACCTGCCGCTGACCGAGCCCGGACAGGAGCGAGGGGCGGCCCCGGCCGGCGCCGCCGGCCCG
CACGACGCCTCGCAGCGGGACCGCCGGAGCAACAAGTTCGACATGGGCAACTTCAAGTTCGGCTTCGGCAAGAGC
AAGCCCGACCCGTCGACGCTCGGCCCGCGCGTCATCCACCTCAACAACCCGCCGGCCAACGCGGCCAACAAGTAC
GTCGACAACCACATCTCGACGGCCAAGTACAACTTCGCCACCTTCCTGCCCAAGTTCCTCTTCGAGCAGTTCTCC
AAGTTCGCAAACATCTTCTTCCTCTTCACCGCCGGCCTGCAGCAGATCCCGGGCCTGTCGCCGACGAACCGCTAC
ACCACCATCGCCCCGCTGCTCATCGTCCTCCTCATCTCGGCGGGCAAGGAGCTGGTGGAGGACTACCGGCGCAAG
CAGGCCGACAACGCGCTCAACACGTCCAAGGCCCGCGTCCTGCGCGGCTCCACCTTCGCCGAGACCAAGTGGATC
AACGTGGCGGTCGGGGACGTGATCCGGGTCGAGTCGGAGGAGCCCTTCCCGGCCGACCTGGTGCTGCTCGCCAGT
TCCGAGCCCGAGGGTCTCTGTTATATCGAGACGGCGAACCTGGACGGCGAGACGAACCTCAAGATCAAGCAGGCC
CTGCCCGAGACGTCGACCATGGTCTCGCCCAGCGAGCTCAGCCGGCTCGGCGGCCGCATCAAGTCGGAGCAGCCC
AACAGCAGCCTCTACACCTACGAGGCGACGCTGACGATGCAGGCCGGCGGCGGCGAGAAGGAGCTGCCGCTGAAC
CCGGAGCAGCTCCTGCTGCGGGGCGCGACGCTGAGGAACACGCCGTGGATCCACGGCGTCGTCGTCTTCACCGGC
CACGAGACCAAGCTGATGAGAAACGCGACGGCCGCCCCAATCAAGCGGACCAAGGTGGAGAAGCAGCTCAACTGG
CTGGTCCTGGTGCTCGTCGGCATGCTGCTCGTCCTGAGCGTCATCTGCACCGTCGGCGACCTGGTGATGCGCAGC
GTCCGGAGCGACTCGCTGCAGTACCTCTACCTGGACCGCATCAACAGCGCGGGCAAGGTGGTGCAGACGTTCGCC
CGTGACATGGTCACCTACTGGGTCCTCTTCTCCTCGCTCGTGCCCATCTCGCTCTTCGTCACGGTCGAGCTGGTC
AAGTACTGGCACGGCATCCTCATCAACGACGACCTCGACATGTACCACGACAAGACGGACACGCCCGCCACCTGC
CGCACCTCGAGCCTGGTCGAGGAGCTGGGCATGGTGGAGTACGTCTTCTCCGACAAGACGGGCACGCTGACGTGC
AACCAGATGGAGTTCAAGCAGTGCACCATCGCCGGCGTCCAGTACGCCGACGAGGTGCCCGAGGACCGGCGGGCG
ACGGCGCACGACGACGCCGACGGCGCCATCCACGACTTCGCCCGGCTCAAGGCGAACCTGGCCGAGGGCCACGAG
ACGGCGCCGGCCATCGACCACTTCCTGTCGCTGCTGGCCATCTGCCACACCGTCATCCCCGAGATGAACGAGAAG
GGCCAGATCAAGTACCAGGCCGCGTCGCCGGACGAGGGCGCGCTCGTGTCGGGCGCCGTCGAGCTGGGCTACCGC
TTCACGGCGCGCAAGCCCAAGTCGGTCATCATCGAGGCGGGCGGGCGCGAGCTCGAGTTCGAGCTGCTGGCCGTC
TGCGAGTTCAACTCGACGCGCAAGCGCATGTCGGCCATCTACCGCTGCCCGGACGGCAAGATCCGCTGCTACTGC
AAGGGCGCCGACACGGTCATCCTCGAGCGGCTCAACGACCAGAACCCGCACGTGGAGGCGACGCTGCGGCACCTG
GAGGAGTACGCGTCGGAGGGCCTGCGGACGCTGTGCCTGGCGATGCGCGAGATACCGGAGCAGGAGTTCGCCGAG
TGGAGCCAGCTCTTCGAGGCGGCGGCGACGACGGTCGGCGGCAACCGGGCCGACGAGCTGGACAAGGCGGCCGAG
ATCATCGAGCACGACTTCTTTCTGCTGGGCGCGACGGCCATCGAGGACCGGCTCCAGGACGGGGTGCCCGAGACG
ATCCACACGCTGCAGCAGGCCAACATCAAGGTGTGGGTGCTGACGGGCGACCGGCAGGAGACGGCCATCAACATC
GGCATGAGCTGCAAGCTGCTGAGCGAGGACATGATGCTGCTGATCGTCAACGAGGAGAGCGCGGCGGCGACGGGC
GACAACCTGCAGAAGAAGCTGGACGCGATCCGGACGCAGGCGGACGGGACGATCGAGACGGAGACGCTGGCGCTC
ATCATCGACGGCAAGTCGCTGACGTACGCGCTCGAGAAGGAGCTGGAGAAGCTGTTCCTGGACCTGGCCGTCATG
TGCAAGGCCGTCATCTGCTGCCGGGTGTCGCCGCTGCAGAAGGCGCTGGTGGTGAAGCTGGTGAAGCGGTACCAG
AAGGAGTCGATCCTGCTGGCCATCGGCGACGGGGCCAACGACGTGTCGATGATCCAGGCGGCGCACATCGGGGTC
GGCATCAGCGGCATGGAGGGGCTGCAGGCGGCGCGGAGCGCCGACGTGGCCATCGCGCAGTTCCGGTACCTGCGC
AAGCTGCTGCTGGTGCACGGGGCGTGGAGCTACCAGCGCGTGAGCAAGACGATACTCTTTTCCTTTTACAAGAAC
ATTGCGCTGTACATGACGCAGTTTTGGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail