Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11067
Gene name
LocationContig_958:2421..4191
Strand+
Gene length (bp)1770
Transcript length (bp)1668
Coding sequence length (bp)1668
Protein length (aa) 556

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10510 PIG-S Phosphatidylinositol-glycan biosynthesis class S protein 3.0E-164 50 540

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10351|PIGS_SCHPO GPI transamidase component PIG-S homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi17 PE=3 SV=1 231 542 2.0E-32
sp|Q04080|GPI17_YEAST GPI transamidase component GPI17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI17 PE=1 SV=1 39 553 4.0E-32
sp|Q5XI31|PIGS_RAT GPI transamidase component PIG-S OS=Rattus norvegicus GN=Pigs PE=2 SV=3 241 533 2.0E-19
sp|Q3SZL5|PIGS_BOVIN GPI transamidase component PIG-S OS=Bos taurus GN=PIGS PE=2 SV=3 254 533 3.0E-19
sp|Q96S52|PIGS_HUMAN GPI transamidase component PIG-S OS=Homo sapiens GN=PIGS PE=1 SV=3 241 533 5.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10351|PIGS_SCHPO GPI transamidase component PIG-S homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi17 PE=3 SV=1 231 542 2.0E-32
sp|Q04080|GPI17_YEAST GPI transamidase component GPI17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI17 PE=1 SV=1 39 553 4.0E-32
sp|Q5XI31|PIGS_RAT GPI transamidase component PIG-S OS=Rattus norvegicus GN=Pigs PE=2 SV=3 241 533 2.0E-19
sp|Q3SZL5|PIGS_BOVIN GPI transamidase component PIG-S OS=Bos taurus GN=PIGS PE=2 SV=3 254 533 3.0E-19
sp|Q96S52|PIGS_HUMAN GPI transamidase component PIG-S OS=Homo sapiens GN=PIGS PE=1 SV=3 241 533 5.0E-19
sp|Q6PD26|PIGS_MOUSE GPI transamidase component PIG-S OS=Mus musculus GN=Pigs PE=1 SV=3 241 533 5.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0042765 GPI-anchor transamidase complex Yes
GO:0016255 attachment of GPI anchor to protein Yes
GO:0044446 intracellular organelle part No
GO:0006464 cellular protein modification process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0044432 endoplasmic reticulum part No
GO:0019538 protein metabolic process No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0044425 membrane part No
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1902494 catalytic complex No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0044267 cellular protein metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0036211 protein modification process No
GO:0044422 organelle part No
GO:0098796 membrane protein complex No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.5

Transmembrane Domains

Domain # Start End Length
1 46 64 18
2 513 535 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11067
MGTVESPSDAVDAVPVAMPADDATATVAPQKQPPPEKPSETRRRTLVVLSFWLVVVALGLPIWWKTTTIYRANLP
LDRMLQWAEGKACRPVFPLQISVRAAALARQEAQHLVRLTQHALDDLDDFSGHHLRLQLAPEQDGAASAAAHAEQ
EPALTVRLLPGRASSSSLDPHTAVLNVTYPPNLIPPPNVSSSVLASFVADELRSTFAEEQSIMSYMLSTSSMSPG
GARRQTQGAGGAEALSKRTTKSLRYAPTYHLTFSLFTDGAVPSTWDIEAAVDEYMKPVLDVLRPIHNFTMDTQVQ
LYATPGVQSPVLSKEHLASFINAAEWPLSPSIGGAPTVNFVVFVGNQTIGLGADAGADAAGVETSQSWTIPQWGS
VYLLPLTATATHVSRETLKQPMLTFGGQLLSLLGTPQAGSLPLRLSALGRIRSTDLVLRASSTLGSLARLSRALP
SISIPRSVAEGVSSTLHHLDRACASLGQPDGLRHARIAEQEAERAFFEKSMVGQLYFPDEHKIAVYLPLLGPVGV
PLVLGLVNELKRWLRRRSQRARDAEDKKSL*
Coding >Hirsu2|11067
ATGGGCACCGTCGAGTCTCCCTCCGACGCCGTCGACGCCGTGCCCGTCGCCATGCCGGCCGACGATGCCACCGCC
ACGGTCGCACCTCAGAAGCAGCCGCCGCCCGAGAAGCCGTCCGAGACGCGCAGGCGAACCCTCGTCGTCCTTTCC
TTCTGGCTCGTCGTCGTCGCTCTTGGCCTTCCGATATGGTGGAAGACGACGACTATCTACCGGGCCAACCTGCCC
CTGGACCGCATGCTGCAATGGGCTGAGGGCAAGGCCTGCCGCCCCGTCTTTCCCCTCCAAATCTCCGTCCGCGCC
GCCGCCCTCGCCCGCCAGGAGGCCCAGCACCTCGTCCGCCTGACGCAGCACGCGCTCGACGACCTCGACGACTTC
TCCGGTCACCACCTGCGCCTGCAGCTGGCCCCCGAACAAGACGGCGCCGCCTCGGCCGCCGCGCACGCGGAACAG
GAGCCGGCCCTGACGGTACGCCTGCTGCCCGGCCGTGCGAGCTCCTCGTCGCTCGACCCGCACACGGCCGTGCTC
AACGTCACCTACCCCCCCAACTTGATTCCGCCACCCAACGTGAGCTCGTCGGTCCTGGCCTCGTTCGTCGCCGAC
GAGCTGCGGTCGACGTTTGCCGAGGAGCAGTCCATCATGTCGTACATGCTCTCGACCTCGTCCATGTCGCCGGGC
GGCGCGCGACGGCAGACGCAGGGCGCGGGCGGCGCCGAGGCGCTGTCGAAGCGGACGACCAAGTCGCTCCGCTAC
GCGCCCACCTACCACCTGACCTTCTCCCTTTTCACCGACGGCGCCGTGCCCAGCACGTGGGACATCGAGGCGGCC
GTCGACGAGTACATGAAGCCCGTGCTGGACGTGCTGCGGCCCATCCACAACTTCACCATGGACACGCAGGTGCAG
CTGTATGCGACGCCGGGCGTGCAGTCGCCCGTGCTCAGCAAGGAGCACCTGGCCTCCTTCATCAACGCGGCCGAG
TGGCCGCTGTCGCCGTCGATCGGCGGCGCGCCGACGGTCAACTTTGTCGTCTTCGTCGGCAACCAGACAATAGGA
CTCGGCGCCGACGCCGGGGCCGATGCCGCCGGGGTCGAGACGTCGCAGTCGTGGACGATCCCGCAGTGGGGCAGC
GTCTACCTGCTGCCGCTAACGGCGACGGCGACGCACGTGTCGCGCGAGACGCTCAAGCAGCCGATGCTGACGTTC
GGCGGGCAGCTGCTGTCGCTGCTGGGCACGCCGCAGGCCGGCTCGCTGCCGCTGCGGCTGTCGGCGCTGGGCCGG
ATCCGGTCGACGGACCTGGTGCTGCGGGCGTCGTCGACGCTGGGCTCGCTGGCACGGCTGTCGCGCGCGCTGCCG
TCCATCTCGATCCCGCGCAGCGTCGCCGAGGGCGTGTCGTCGACGCTGCACCACCTGGACCGCGCCTGCGCCAGC
CTGGGCCAGCCCGACGGGCTGCGGCACGCGCGCATCGCCGAGCAGGAGGCCGAGCGCGCCTTTTTCGAGAAGAGC
ATGGTCGGCCAGCTGTACTTCCCGGACGAGCACAAGATCGCCGTGTACCTGCCGCTGCTGGGGCCCGTCGGCGTG
CCGCTGGTCCTGGGGCTGGTCAACGAGCTGAAGCGGTGGCTGAGGAGGCGGAGCCAGCGGGCCCGCGACGCCGAG
GACAAGAAGAGCCTGTGA
Transcript >Hirsu2|11067
ATGGGCACCGTCGAGTCTCCCTCCGACGCCGTCGACGCCGTGCCCGTCGCCATGCCGGCCGACGATGCCACCGCC
ACGGTCGCACCTCAGAAGCAGCCGCCGCCCGAGAAGCCGTCCGAGACGCGCAGGCGAACCCTCGTCGTCCTTTCC
TTCTGGCTCGTCGTCGTCGCTCTTGGCCTTCCGATATGGTGGAAGACGACGACTATCTACCGGGCCAACCTGCCC
CTGGACCGCATGCTGCAATGGGCTGAGGGCAAGGCCTGCCGCCCCGTCTTTCCCCTCCAAATCTCCGTCCGCGCC
GCCGCCCTCGCCCGCCAGGAGGCCCAGCACCTCGTCCGCCTGACGCAGCACGCGCTCGACGACCTCGACGACTTC
TCCGGTCACCACCTGCGCCTGCAGCTGGCCCCCGAACAAGACGGCGCCGCCTCGGCCGCCGCGCACGCGGAACAG
GAGCCGGCCCTGACGGTACGCCTGCTGCCCGGCCGTGCGAGCTCCTCGTCGCTCGACCCGCACACGGCCGTGCTC
AACGTCACCTACCCCCCCAACTTGATTCCGCCACCCAACGTGAGCTCGTCGGTCCTGGCCTCGTTCGTCGCCGAC
GAGCTGCGGTCGACGTTTGCCGAGGAGCAGTCCATCATGTCGTACATGCTCTCGACCTCGTCCATGTCGCCGGGC
GGCGCGCGACGGCAGACGCAGGGCGCGGGCGGCGCCGAGGCGCTGTCGAAGCGGACGACCAAGTCGCTCCGCTAC
GCGCCCACCTACCACCTGACCTTCTCCCTTTTCACCGACGGCGCCGTGCCCAGCACGTGGGACATCGAGGCGGCC
GTCGACGAGTACATGAAGCCCGTGCTGGACGTGCTGCGGCCCATCCACAACTTCACCATGGACACGCAGGTGCAG
CTGTATGCGACGCCGGGCGTGCAGTCGCCCGTGCTCAGCAAGGAGCACCTGGCCTCCTTCATCAACGCGGCCGAG
TGGCCGCTGTCGCCGTCGATCGGCGGCGCGCCGACGGTCAACTTTGTCGTCTTCGTCGGCAACCAGACAATAGGA
CTCGGCGCCGACGCCGGGGCCGATGCCGCCGGGGTCGAGACGTCGCAGTCGTGGACGATCCCGCAGTGGGGCAGC
GTCTACCTGCTGCCGCTAACGGCGACGGCGACGCACGTGTCGCGCGAGACGCTCAAGCAGCCGATGCTGACGTTC
GGCGGGCAGCTGCTGTCGCTGCTGGGCACGCCGCAGGCCGGCTCGCTGCCGCTGCGGCTGTCGGCGCTGGGCCGG
ATCCGGTCGACGGACCTGGTGCTGCGGGCGTCGTCGACGCTGGGCTCGCTGGCACGGCTGTCGCGCGCGCTGCCG
TCCATCTCGATCCCGCGCAGCGTCGCCGAGGGCGTGTCGTCGACGCTGCACCACCTGGACCGCGCCTGCGCCAGC
CTGGGCCAGCCCGACGGGCTGCGGCACGCGCGCATCGCCGAGCAGGAGGCCGAGCGCGCCTTTTTCGAGAAGAGC
ATGGTCGGCCAGCTGTACTTCCCGGACGAGCACAAGATCGCCGTGTACCTGCCGCTGCTGGGGCCCGTCGGCGTG
CCGCTGGTCCTGGGGCTGGTCAACGAGCTGAAGCGGTGGCTGAGGAGGCGGAGCCAGCGGGCCCGCGACGCCGAG
GACAAGAAGAGCCTGTGA
Gene >Hirsu2|11067
ATGGGCACCGTCGAGTCTCCCTCCGACGCCGTCGACGCCGTGCCCGTCGCCATGCCGGCCGACGATGCCACCGCC
ACGGTCGCACCTCAGAAGCAGCCGCCGCCCGAGAAGCCGTCCGAGACGCGCAGGCGAACCCTCGTCGTCCTTTCC
TTCTGGCTCGTCGTCGTCGCTCTTGGCCTTCCGATATGGTGGAAGACGACGACTATCTACCGGGCCAACCTGCCC
CTGGACCGCATGCTGCAATGGGCTGAGGGCAAGGTTCGCTTCTTCTCCTCCTTTTCTGTTCCTCTACTCTTCCTC
TCCTCCTCCTCCTCCTCCTGCCCTCTTACAGCTCATTCGCTGACACGTATGCCCCGATAGGCCTGCCGCCCCGTC
TTTCCCCTCCAAATCTCCGTCCGCGCCGCCGCCCTCGCCCGCCAGGAGGCCCAGCACCTCGTCCGCCTGACGCAG
CACGCGCTCGACGACCTCGACGACTTCTCCGGTCACCACCTGCGCCTGCAGCTGGCCCCCGAACAAGACGGCGCC
GCCTCGGCCGCCGCGCACGCGGAACAGGAGCCGGCCCTGACGGTACGCCTGCTGCCCGGCCGTGCGAGCTCCTCG
TCGCTCGACCCGCACACGGCCGTGCTCAACGTCACCTACCCCCCCAACTTGATTCCGCCACCCAACGTGAGCTCG
TCGGTCCTGGCCTCGTTCGTCGCCGACGAGCTGCGGTCGACGTTTGCCGAGGAGCAGTCCATCATGTCGTACATG
CTCTCGACCTCGTCCATGTCGCCGGGCGGCGCGCGACGGCAGACGCAGGGCGCGGGCGGCGCCGAGGCGCTGTCG
AAGCGGACGACCAAGTCGCTCCGCTACGCGCCCACCTACCACCTGACCTTCTCCCTTTTCACCGACGGCGCCGTG
CCCAGCACGTGGGACATCGAGGCGGCCGTCGACGAGTACATGAAGCCCGTGCTGGACGTGCTGCGGCCCATCCAC
AACTTCACCATGGACACGCAGGTGCAGCTGTATGCGACGCCGGGCGTGCAGTCGCCCGTGCTCAGCAAGGAGCAC
CTGGCCTCCTTCATCAACGCGGCCGAGTGGCCGCTGTCGCCGTCGATCGGCGGCGCGCCGACGGTCAACTTTGTC
GTCTTCGTCGGCAACCAGACAATAGGACTCGGCGCCGACGCCGGGGCCGATGCCGCCGGGGTCGAGACGTCGCAG
TCGTGGACGATCCCGCAGTGGGGCAGCGTCTACCTGCTGCCGCTAACGGCGACGGCGACGCACGTGTCGCGCGAG
ACGCTCAAGCAGCCGATGCTGACGTTCGGCGGGCAGCTGCTGTCGCTGCTGGGCACGCCGCAGGCCGGCTCGCTG
CCGCTGCGGCTGTCGGCGCTGGGCCGGATCCGGTCGACGGACCTGGTGCTGCGGGCGTCGTCGACGCTGGGCTCG
CTGGCACGGCTGTCGCGCGCGCTGCCGTCCATCTCGATCCCGCGCAGCGTCGCCGAGGGCGTGTCGTCGACGCTG
CACCACCTGGACCGCGCCTGCGCCAGCCTGGGCCAGCCCGACGGGCTGCGGCACGCGCGCATCGCCGAGCAGGAG
GCCGAGCGCGCCTTTTTCGAGAAGAGCATGGTCGGCCAGCTGTACTTCCCGGACGAGCACAAGATCGCCGTGTAC
CTGCCGCTGCTGGGGCCCGTCGGCGTGCCGCTGGTCCTGGGGCTGGTCAACGAGCTGAAGCGGTGGCTGAGGAGG
CGGAGCCAGCGGGCCCGCGACGCCGAGGACAAGAAGAGCCTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail