Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11063
Gene name
LocationContig_957:2812..4126
Strand+
Gene length (bp)1314
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01184 Gpr1_Fun34_YaaH GPR1/FUN34/yaaH family 3.1E-30 62 270

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q24JP1|ALCS_ASPFU Protein alcS OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alcS PE=3 SV=1 10 284 1.0E-55
sp|B0YBR5|ALCS_ASPFC Protein alcS OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=alcS PE=3 SV=2 10 284 1.0E-55
sp|Q460G9|ALCS_EMENI Protein alcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcS PE=2 SV=1 38 274 2.0E-48
sp|O14201|MUG86_SCHPO Meiotically up-regulated gene 86 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug86 PE=1 SV=1 65 253 1.0E-07
sp|P41943|GPR1_YARLI Glyoxylate pathway regulator OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPR1 PE=1 SV=3 61 228 5.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q24JP1|ALCS_ASPFU Protein alcS OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alcS PE=3 SV=1 10 284 1.0E-55
sp|B0YBR5|ALCS_ASPFC Protein alcS OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=alcS PE=3 SV=2 10 284 1.0E-55
sp|Q460G9|ALCS_EMENI Protein alcS OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcS PE=2 SV=1 38 274 2.0E-48
sp|O14201|MUG86_SCHPO Meiotically up-regulated gene 86 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug86 PE=1 SV=1 65 253 1.0E-07
sp|P41943|GPR1_YARLI Glyoxylate pathway regulator OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPR1 PE=1 SV=3 61 228 5.0E-07
sp|Q5B2K4|ACPA_EMENI Acetate permease A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acpA PE=2 SV=1 64 288 7.0E-07
sp|O26317|Y215_METTH Uncharacterized protein MTH_215 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_215 PE=3 SV=1 68 220 2.0E-06
sp|P0ACA0|SATP_SHIFL Succinate-acetate/proton symporter SatP OS=Shigella flexneri GN=satP PE=3 SV=1 68 260 4.0E-06
sp|P0AC98|SATP_ECOLI Succinate-acetate/proton symporter SatP OS=Escherichia coli (strain K12) GN=satP PE=1 SV=1 68 260 4.0E-06
sp|P0AC99|SATP_ECO57 Succinate-acetate/proton symporter SatP OS=Escherichia coli O157:H7 GN=satP PE=3 SV=1 68 260 4.0E-06
sp|P32907|ATO2_YEAST Ammonia transport outward protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATO2 PE=1 SV=1 13 214 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 72 91 19
2 101 123 22
3 130 152 22
4 172 194 22
5 199 218 19
6 233 255 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11063
MEEEGRAGNMKTSGGGSYSEQGTEEERLEALNKFRTATSVSMSPELFEKLYLSPKNHIKGELRQTFGNPSPIGLA
GFLICLTPLSMDLMGWRGAGGNGAASIGSFFFQGGFLMNLGCILEWVLGNTFPAVVFGVYGTFWLAHGATLNPSF
AAYALYAPPGRPAAEGLRTQGFNASVAWWFLFMGLISLIFFICALRTNVCLCFIFFCLTISYALQTAGKIKQAED
YHGNEHLAHTLGKAAGGMLFAACWSGWYILLGELLAAVDFPIQVCVGDLSTVIKGRRERMRSKES*
Coding >Hirsu2|11063
ATGGAGGAAGAAGGCCGGGCGGGCAACATGAAGACCAGCGGCGGCGGCAGCTACAGCGAGCAGGGCACCGAGGAG
GAGCGGCTCGAGGCCCTCAACAAGTTCCGCACCGCCACCAGCGTCTCCATGAGCCCCGAGCTGTTCGAGAAGCTG
TACCTGTCGCCCAAGAACCACATCAAGGGCGAGCTGCGCCAGACGTTTGGCAACCCCAGTCCCATTGGTCTGGCC
GGCTTCCTCATCTGCCTGACGCCCCTGTCCATGGACCTCATGGGCTGGCGAGGAGCAGGCGGCAACGGCGCCGCG
AGCATCGGCTCCTTCTTCTTCCAGGGAGGCTTCCTCATGAATCTCGGCTGCATCCTCGAATGGGTCCTGGGCAAC
ACCTTTCCGGCCGTCGTCTTCGGCGTCTACGGCACCTTCTGGCTCGCCCACGGCGCGACCCTCAACCCGTCCTTC
GCCGCCTACGCCTTGTACGCGCCGCCGGGGAGGCCGGCGGCCGAGGGCCTGCGCACGCAGGGCTTCAACGCCAGC
GTCGCCTGGTGGTTCCTCTTCATGGGCCTCATCTCCCTCATCTTCTTCATCTGCGCGCTCCGCACAAACGTCTGC
CTGTGCTTCATCTTCTTCTGCCTCACCATCTCGTACGCGCTGCAGACGGCCGGCAAGATCAAGCAGGCCGAGGAC
TACCACGGCAACGAGCACCTGGCCCACACGCTGGGTAAAGCCGCCGGCGGCATGCTCTTCGCCGCCTGCTGGTCC
GGCTGGTACATCCTGCTGGGCGAGCTGCTGGCCGCCGTCGACTTCCCGATCCAGGTCTGCGTCGGCGATCTCAGC
ACCGTCATCAAGGGCCGCCGCGAGCGCATGCGCTCCAAGGAGTCATAG
Transcript >Hirsu2|11063
ATGGAGGAAGAAGGCCGGGCGGGCAACATGAAGACCAGCGGCGGCGGCAGCTACAGCGAGCAGGGCACCGAGGAG
GAGCGGCTCGAGGCCCTCAACAAGTTCCGCACCGCCACCAGCGTCTCCATGAGCCCCGAGCTGTTCGAGAAGCTG
TACCTGTCGCCCAAGAACCACATCAAGGGCGAGCTGCGCCAGACGTTTGGCAACCCCAGTCCCATTGGTCTGGCC
GGCTTCCTCATCTGCCTGACGCCCCTGTCCATGGACCTCATGGGCTGGCGAGGAGCAGGCGGCAACGGCGCCGCG
AGCATCGGCTCCTTCTTCTTCCAGGGAGGCTTCCTCATGAATCTCGGCTGCATCCTCGAATGGGTCCTGGGCAAC
ACCTTTCCGGCCGTCGTCTTCGGCGTCTACGGCACCTTCTGGCTCGCCCACGGCGCGACCCTCAACCCGTCCTTC
GCCGCCTACGCCTTGTACGCGCCGCCGGGGAGGCCGGCGGCCGAGGGCCTGCGCACGCAGGGCTTCAACGCCAGC
GTCGCCTGGTGGTTCCTCTTCATGGGCCTCATCTCCCTCATCTTCTTCATCTGCGCGCTCCGCACAAACGTCTGC
CTGTGCTTCATCTTCTTCTGCCTCACCATCTCGTACGCGCTGCAGACGGCCGGCAAGATCAAGCAGGCCGAGGAC
TACCACGGCAACGAGCACCTGGCCCACACGCTGGGTAAAGCCGCCGGCGGCATGCTCTTCGCCGCCTGCTGGTCC
GGCTGGTACATCCTGCTGGGCGAGCTGCTGGCCGCCGTCGACTTCCCGATCCAGGTCTGCGTCGGCGATCTCAGC
ACCGTCATCAAGGGCCGCCGCGAGCGCATGCGCTCCAAGGAGTCATAG
Gene >Hirsu2|11063
ATGGAGGAAGAAGGCCGGGCGGGCAACATGAAGACCAGCGGCGGCGGCAGCTACAGCGAGCAGGGCACCGAGGAG
GAGCGGCTCGAGGCCCTCAACAAGTTCCGCACCGCCACCAGCGTCTCCATGAGCCCCGAGCTGTTCGAGAAGCTG
TACCTGTCGCCCAAGAACCACATCAAGGGCGAGCTGCGCCAGACGTTTGGCAACCCCAGTCCCATGTCCGTCTCT
CTCTCCCGCGGCAGGATGGCGGGAAACGAGCTTTGTTGTCGTGCTCGAGTGCTGACGCGGCCGCAGTGGTCTGGC
CGGCTTCCTCATCTGCCTGACGCCCCTGTCCATGGACCTCATGGGCTGGCGAGGAGCAGGCGGCAACGGCGCCGC
GAGCATGTACGTTCGATACCCCTGTCTCCCCTCTCTTCCTCTCCCGTTGTTGTCTCTTCCCCCGAGACTCGGTTT
GATTCTCCCGCTGACACGGCGCGCTCTCCCTCCGCCGCAGCGGCTCCTTCTTCTTCCAGGGAGGCTTCCTCATGA
ATCTCGGCTGCATCCTCGAATGGGTCCTGGGCAACACCTTTCCGGCCGTCGTCTTCGGCGTCTACGGCACCTTCT
GGCTCGCCCACGGCGCGACCCTCAACCCGTCCTTCGCCGCCTACGCCTTGTACGCGCCGCCGGGGAGGCCGGCGG
CCGAGGGCCTGCGCACGCAGGGCTTCAACGCCAGCGTCGGTAAGGAGAGACCCCGTCTGTTTGTCGAAGGGGGGG
GGAGACGAAAGAGTAGAGCCGAAAAGCTCTGTGGCGGACAAGGCTCGGCTGACCCGTGGGATGAAATACCGCAGC
CTGGTGGTTCCTCTTCATGGGCCTCATCTCCCTCATCTTCTTCATCTGCGCGCTCCGCACAAACGTCTGCCTGTG
CTTCATCTTCTTCTGCCTCACCATCTCGTACGCGCTGCAGACGGCCGGCAAGATCAAGCAGGCCGAGGACTACCA
CGGCAACGAGCACCTGGCCCACACGCTGGGTAAAGTACGTCTCGTCCTCCTTGAATTTCTCTTTCTCCTGTTCCT
CTCGCCTACCCCTTTCTATCCGTCTTCCCCCTTTTCCCACCTCCCGCCACTCTTCCTCCTCCCCCCCCCTATCGT
CTCTCTCCGGCACTGACCCGTCTTCTCAAGGCCGCCGGCGGCATGCTCTTCGCCGCCTGCTGGTCCGGCTGGTAC
ATCCTGCTGGGCGAGCTGCTGGCCGCCGTCGACTTCCCGATCCAGGTCTGCGTCGGCGATCTCAGCACCGTCATC
AAGGGCCGCCGCGAGCGCATGCGCTCCAAGGAGTCATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail