Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11060
Gene name
LocationContig_955:6043..8141
Strand-
Gene length (bp)2098
Transcript length (bp)1923
Coding sequence length (bp)1923
Protein length (aa) 641

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00441 Acyl-CoA_dh_1 Acyl-CoA dehydrogenase, C-terminal domain 6.8E-14 325 507
PF18158 AidB_N Adaptive response protein AidB N-terminal domain 1.1E-11 18 154
PF02770 Acyl-CoA_dh_M Acyl-CoA dehydrogenase, middle domain 1.3E-09 193 315

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XWZ2|ACD11_CAEEL Acyl-CoA dehydrogenase family member 11 OS=Caenorhabditis elegans GN=acdh-11 PE=1 SV=1 9 628 4.0E-81
sp|P33224|AIDB_ECOLI Putative acyl-CoA dehydrogenase AidB OS=Escherichia coli (strain K12) GN=aidB PE=1 SV=3 191 513 9.0E-29
sp|Q5LLW7|DMDC_RUEPO 3-methylmercaptopropionyl-CoA dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdC PE=1 SV=1 188 505 2.0E-13
sp|Q07417|ACADS_MOUSE Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acads PE=1 SV=2 192 499 3.0E-06
sp|P15651|ACADS_RAT Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Acads PE=1 SV=2 192 499 4.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XWZ2|ACD11_CAEEL Acyl-CoA dehydrogenase family member 11 OS=Caenorhabditis elegans GN=acdh-11 PE=1 SV=1 9 628 4.0E-81
sp|P33224|AIDB_ECOLI Putative acyl-CoA dehydrogenase AidB OS=Escherichia coli (strain K12) GN=aidB PE=1 SV=3 191 513 9.0E-29
sp|Q5LLW7|DMDC_RUEPO 3-methylmercaptopropionyl-CoA dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdC PE=1 SV=1 188 505 2.0E-13
sp|Q07417|ACADS_MOUSE Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acads PE=1 SV=2 192 499 3.0E-06
sp|P15651|ACADS_RAT Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Acads PE=1 SV=2 192 499 4.0E-06
sp|Q3ZBF6|ACADS_BOVIN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=ACADS PE=1 SV=1 233 499 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11060
MNPSGADRGFFQEAPVLANQFYDDASFRRCFRLFLPADTRAKTEADVAALGRDVLDDQVFAWITDAERNEPHLRG
SGRDVFGRRSSQLVTAAGWRELHRFSTSRGMVACGYDTPFGPFSRPLQFLRTLLWTPSCANVGCPSAMQDGAASL
LRKHLTTPGLASGLSAEQRRVFEDAYARLTSRDPAFAWTSGQWMTERPGGSDVSLTETTAVLEPERGRGGLASGP
QNLPLGPWTISGFKWFSSATDSRMAVLLARTPTGLSAFFAPMHKHNPGATAVATGRPLPDGECLNGVSISRLKDK
SGTRSLPTAELVLEGMRGWLIGQEGRGVHEISAVLNLTRVHSAVSAVGGIGRGLAIARSYARLRQVGNGRGARMG
LAESPLHMRTLAKMTADYRGLMLLSLLASYVVGLSEHPPTADSAPAPALAAMTPAPELTEPLLRVLTQLTKAYVC
KASVPLMFACMESLGGVGYLWNEAQEHLNVARIFRDLCVGPIWEGTTDVLCTDFVRALKHPKGGAGSLAALEDII
RKGSTFEGRLHGPNGWRPAQRWAALKSRVASEAQADLMSEAREIVWEVADILVSVLLYLDASTDGDSAAADIFLR
FLEARDWTPRRAKGTTDEELRRDRAIVYGTGGLASPPPKL*
Coding >Hirsu2|11060
ATGAATCCCTCTGGTGCCGACCGAGGCTTCTTCCAGGAGGCGCCCGTCCTCGCCAACCAGTTCTACGACGACGCC
TCTTTCCGCCGCTGCTTCCGACTGTTCCTGCCGGCCGATACAAGGGCCAAGACGGAGGCGGACGTGGCCGCCCTC
GGACGCGACGTTCTCGATGACCAAGTCTTCGCGTGGATCACCGATGCCGAACGCAACGAGCCCCATCTGAGGGGC
AGCGGCCGCGATGTCTTCGGCCGGAGGTCCTCCCAGCTGGTCACGGCCGCGGGCTGGCGCGAGCTGCACAGGTTC
AGCACGTCCAGGGGCATGGTCGCCTGCGGCTACGACACTCCCTTCGGGCCCTTCTCCCGCCCGCTGCAGTTCCTC
CGCACCCTCCTGTGGACGCCGTCCTGCGCCAACGTCGGCTGTCCTTCCGCCATGCAGGACGGCGCCGCGAGTCTG
CTGAGGAAGCACCTGACGACGCCCGGCCTCGCCTCCGGGCTGTCGGCCGAGCAGCGCCGGGTCTTCGAGGACGCC
TATGCGAGGCTCACCTCGCGCGACCCCGCCTTCGCCTGGACCAGCGGCCAGTGGATGACGGAGCGGCCTGGCGGC
AGTGACGTTTCCCTGACGGAGACGACTGCCGTTCTGGAGCCCGAACGGGGCCGGGGAGGATTGGCCTCGGGGCCG
CAGAACCTCCCCCTCGGCCCCTGGACCATCAGCGGCTTCAAGTGGTTCTCCAGCGCGACTGACAGCCGCATGGCC
GTGCTGCTGGCCCGGACCCCCACGGGGCTCTCCGCCTTCTTCGCGCCCATGCACAAGCACAATCCGGGCGCCACG
GCCGTGGCCACCGGACGGCCGCTTCCGGACGGCGAGTGCCTCAACGGCGTCTCCATCTCGCGACTGAAGGACAAG
TCCGGCACGCGGTCGCTCCCCACCGCCGAGCTGGTCCTCGAGGGCATGCGCGGCTGGCTCATCGGCCAGGAGGGC
CGGGGCGTCCATGAGATCAGCGCCGTCTTGAACCTGACGAGGGTTCACTCGGCCGTCAGCGCCGTCGGGGGCATC
GGCCGCGGCTTGGCCATCGCGAGGTCGTACGCGCGCCTGCGCCAGGTCGGCAACGGCCGTGGCGCCAGGATGGGC
CTGGCCGAGAGCCCCCTGCACATGAGGACGCTTGCCAAGATGACGGCTGACTACCGCGGCTTGATGCTCCTCAGC
CTCCTCGCCAGCTACGTCGTCGGCCTCAGCGAGCATCCGCCGACAGCCGACTCGGCCCCGGCCCCGGCCCTGGCT
GCCATGACGCCTGCTCCGGAGCTGACCGAGCCCCTGCTACGCGTCCTGACGCAACTCACCAAGGCCTACGTGTGC
AAGGCCTCGGTGCCCCTCATGTTCGCCTGCATGGAGTCTCTCGGCGGAGTCGGATACCTCTGGAACGAGGCCCAG
GAGCATCTCAACGTGGCCAGGATCTTCCGCGACCTCTGCGTCGGGCCCATCTGGGAGGGCACCACGGACGTGCTA
TGCACGGATTTTGTCCGGGCCCTGAAGCACCCCAAGGGCGGCGCCGGCTCGCTCGCCGCGCTTGAAGACATCATC
CGCAAGGGGAGCACCTTCGAGGGCAGGTTGCACGGGCCGAACGGATGGCGTCCGGCCCAGAGATGGGCTGCCTTG
AAGAGCCGCGTCGCCAGCGAAGCCCAAGCCGACCTCATGTCCGAAGCCAGGGAAATTGTCTGGGAAGTGGCAGAT
ATCCTCGTGTCGGTGCTGCTGTACCTAGACGCTAGCACCGACGGAGACTCGGCCGCGGCAGACATCTTCTTGCGC
TTCCTCGAGGCTAGGGACTGGACGCCGCGACGGGCGAAGGGAACGACGGACGAGGAGCTGCGCAGGGACCGGGCC
ATAGTCTACGGCACCGGCGGCTTGGCCAGTCCTCCCCCAAAGCTTTGA
Transcript >Hirsu2|11060
ATGAATCCCTCTGGTGCCGACCGAGGCTTCTTCCAGGAGGCGCCCGTCCTCGCCAACCAGTTCTACGACGACGCC
TCTTTCCGCCGCTGCTTCCGACTGTTCCTGCCGGCCGATACAAGGGCCAAGACGGAGGCGGACGTGGCCGCCCTC
GGACGCGACGTTCTCGATGACCAAGTCTTCGCGTGGATCACCGATGCCGAACGCAACGAGCCCCATCTGAGGGGC
AGCGGCCGCGATGTCTTCGGCCGGAGGTCCTCCCAGCTGGTCACGGCCGCGGGCTGGCGCGAGCTGCACAGGTTC
AGCACGTCCAGGGGCATGGTCGCCTGCGGCTACGACACTCCCTTCGGGCCCTTCTCCCGCCCGCTGCAGTTCCTC
CGCACCCTCCTGTGGACGCCGTCCTGCGCCAACGTCGGCTGTCCTTCCGCCATGCAGGACGGCGCCGCGAGTCTG
CTGAGGAAGCACCTGACGACGCCCGGCCTCGCCTCCGGGCTGTCGGCCGAGCAGCGCCGGGTCTTCGAGGACGCC
TATGCGAGGCTCACCTCGCGCGACCCCGCCTTCGCCTGGACCAGCGGCCAGTGGATGACGGAGCGGCCTGGCGGC
AGTGACGTTTCCCTGACGGAGACGACTGCCGTTCTGGAGCCCGAACGGGGCCGGGGAGGATTGGCCTCGGGGCCG
CAGAACCTCCCCCTCGGCCCCTGGACCATCAGCGGCTTCAAGTGGTTCTCCAGCGCGACTGACAGCCGCATGGCC
GTGCTGCTGGCCCGGACCCCCACGGGGCTCTCCGCCTTCTTCGCGCCCATGCACAAGCACAATCCGGGCGCCACG
GCCGTGGCCACCGGACGGCCGCTTCCGGACGGCGAGTGCCTCAACGGCGTCTCCATCTCGCGACTGAAGGACAAG
TCCGGCACGCGGTCGCTCCCCACCGCCGAGCTGGTCCTCGAGGGCATGCGCGGCTGGCTCATCGGCCAGGAGGGC
CGGGGCGTCCATGAGATCAGCGCCGTCTTGAACCTGACGAGGGTTCACTCGGCCGTCAGCGCCGTCGGGGGCATC
GGCCGCGGCTTGGCCATCGCGAGGTCGTACGCGCGCCTGCGCCAGGTCGGCAACGGCCGTGGCGCCAGGATGGGC
CTGGCCGAGAGCCCCCTGCACATGAGGACGCTTGCCAAGATGACGGCTGACTACCGCGGCTTGATGCTCCTCAGC
CTCCTCGCCAGCTACGTCGTCGGCCTCAGCGAGCATCCGCCGACAGCCGACTCGGCCCCGGCCCCGGCCCTGGCT
GCCATGACGCCTGCTCCGGAGCTGACCGAGCCCCTGCTACGCGTCCTGACGCAACTCACCAAGGCCTACGTGTGC
AAGGCCTCGGTGCCCCTCATGTTCGCCTGCATGGAGTCTCTCGGCGGAGTCGGATACCTCTGGAACGAGGCCCAG
GAGCATCTCAACGTGGCCAGGATCTTCCGCGACCTCTGCGTCGGGCCCATCTGGGAGGGCACCACGGACGTGCTA
TGCACGGATTTTGTCCGGGCCCTGAAGCACCCCAAGGGCGGCGCCGGCTCGCTCGCCGCGCTTGAAGACATCATC
CGCAAGGGGAGCACCTTCGAGGGCAGGTTGCACGGGCCGAACGGATGGCGTCCGGCCCAGAGATGGGCTGCCTTG
AAGAGCCGCGTCGCCAGCGAAGCCCAAGCCGACCTCATGTCCGAAGCCAGGGAAATTGTCTGGGAAGTGGCAGAT
ATCCTCGTGTCGGTGCTGCTGTACCTAGACGCTAGCACCGACGGAGACTCGGCCGCGGCAGACATCTTCTTGCGC
TTCCTCGAGGCTAGGGACTGGACGCCGCGACGGGCGAAGGGAACGACGGACGAGGAGCTGCGCAGGGACCGGGCC
ATAGTCTACGGCACCGGCGGCTTGGCCAGTCCTCCCCCAAAGCTTTGA
Gene >Hirsu2|11060
ATGAATCCCTCTGGTGCCGACCGAGGCTTCTTCCAGGAGGCGCCCGTCCTCGCCAACCAGTTCTACGACGACGCC
TCTTTCCGCCGCTGCTTCCGACGTGAGTGTCATCCGTGTAGATGCCGCTCTCAAGAACGGGCCCTTGCCATGGCC
GGCCGGCCTTTGCGGCGGCTGTTGACGGCCGGCGACAGTGTTCCTGCCGGCCGATACAAGGGCCAAGACGGAGGC
GGACGTGGCCGCCCTCGGACGCGACGTTCTCGATGACCAAGTCTTCGCGTGGATCACCGATGCCGAACGCAACGA
GCCCCATCTGAGGGGCAGCGGCCGCGATGTCTTCGGCCGGAGGTCCTCCCAGCTGGTCACGGCCGCGGGCTGGCG
CGAGCTGCACAGGTTCAGCACGTCCAGGGGGTAAGTTGCTCACGAGCACGAGATCTGTGGCCGGCGCTCAATCTT
CCTCTCTTCCTCTTCCTTCTCCTCCGTCATCTTCCGTAGCATGGTCGCCTGCGGCTACGACACTCCCTTCGGGCC
CTTCTCCCGCCCGCTGCAGTTCCTCCGCACCCTCCTGTGGACGCCGTCCTGCGCCAACGTCGGCTGTCCTTCCGC
CATGCAGGACGGCGCCGCGAGTCTGCTGAGGAAGCACCTGACGACGCCCGGCCTCGCCTCCGGGCTGTCGGCCGA
GCAGCGCCGGGTCTTCGAGGACGCCTATGCGAGGCTCACCTCGCGCGACCCCGCCTTCGCCTGGACCAGCGGCCA
GTGGATGACGGAGCGGCCTGGCGGCAGTGACGTTTCCCTGACGGAGACGACTGCCGTTCTGGAGCCCGAACGGGG
CCGGGGAGGATTGGCCTCGGGGCCGCAGAACCTCCCCCTCGGCCCCTGGACCATCAGCGGCTTCAAGTGGTTCTC
CAGCGCGACTGACAGCCGCATGGCCGTGCTGCTGGCCCGGACCCCCACGGGGCTCTCCGCCTTCTTCGCGCCCAT
GCACAAGCACAATCCGGGCGCCACGGCCGTGGCCACCGGACGGCCGCTTCCGGACGGCGAGTGCCTCAACGGCGT
CTCCATCTCGCGACTGAAGGACAAGTCCGGCACGCGGTCGCTCCCCACCGCCGAGCTGGTCCTCGAGGGCATGCG
CGGCTGGCTCATCGGCCAGGAGGGCCGGGGCGTCCATGAGATCAGCGCCGTCTTGAACCTGACGAGGGTTCACTC
GGCCGTCAGCGCCGTCGGGGGCATCGGCCGCGGCTTGGCCATCGCGAGGTCGTACGCGCGCCTGCGCCAGGTCGG
CAACGGCCGTGGCGCCAGGATGGGCCTGGCCGAGAGCCCCCTGCACATGAGGACGCTTGCCAAGATGACGGCTGA
CTACCGCGGCTTGATGCTCCTCAGCCTCCTCGCCAGCTACGTCGTCGGCCTCAGCGAGCATCCGCCGACAGCCGA
CTCGGCCCCGGCCCCGGCCCTGGCTGCCATGACGCCTGCTCCGGAGCTGACCGAGCCCCTGCTACGCGTCCTGAC
GCAACTCACCAAGGCCTACGTGTGCAAGGCCTCGGTGCCCCTCATGTTCGCCTGCATGGAGTCTCTCGGCGGAGT
CGGATACCTCTGGAACGAGGCCCAGGAGCATCTCAACGTGGCCAGGATCTTCCGCGACCTCTGCGTCGGGCCCAT
CTGGGAGGGCACCACGGACGTGCTATGCACGGATTTTGTCCGGGCCCTGAAGCACCCCAAGGGCGGCGCCGGCTC
GCTCGCCGCGCTTGAAGACATCATCCGCAAGGGGAGCACCTTCGAGGGCAGGTTGCACGGGCCGAACGGATGGCG
TCCGGCCCAGAGATGGGCTGCCTTGAAGAGCCGCGTCGCCAGCGAAGCCCAAGCCGACCTCATGTCCGAAGCCAG
GGAAATTGTCTGGGAAGTGGCAGATATCCTCGTGTCGGTGCTGCTGTACCTAGACGCTAGCACCGACGGAGACTC
GGCCGCGGCAGACATCTTCTTGCGCTTCCTCGAGGCTAGGGACTGGACGCCGCGACGGGCGAAGGGAACGACGGA
CGAGGAGCTGCGCAGGGACCGGGCCATAGTCTACGGCACCGGCGGCTTGGCCAGTCCTCCCCCAAAGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail