Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11055
Gene name
LocationContig_954:1291..3800
Strand+
Gene length (bp)2509
Transcript length (bp)2157
Coding sequence length (bp)2157
Protein length (aa) 719

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01803 LIM_bind LIM-domain binding protein 5.7E-74 334 581

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74364|ADN1_SCHPO Adhesion defective protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=adn1 PE=3 SV=1 327 568 2.0E-19

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2958 0.9223 0.0468 0.0397 0.0167 0.0008 0.0711 0.0152 0.0209 0.0004

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1470
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7488
Ophiocordyceps australis map64 (Brazil) OphauB2|2537
Ophiocordyceps camponoti-floridani Ophcf2|04312
Ophiocordyceps camponoti-rufipedis Ophun1|176
Ophiocordyceps kimflemingae Ophio5|1152
Ophiocordyceps subramaniannii Hirsu2|11055 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11055
MGPGMPPNAAQQGAPGAGMPQQFGAGHMAVSGPGGQVNPALMGAMPPGANPHALQHLTPAQQQLFQHQQHQQHQQ
HQQQQLQNQFHNPSAMAAIRQHQLLQHQQQQARQALMAQQAVHANMAVGNGIPMGMPLNPQQIQQLRSAGRIGPG
QHPQAQAIMAQQLALQQQQQAQQQHAAQQAAHNQQMSGGPNQGQHMPMGAQNMAGMQQQSQMGGGVQNQMGGQQQ
QGVQQAPGQPQPQPQGQPQQPGQQAQHTPQQTSQAGTPAPSGQQTPSQTPAPAPSQSNQLQQGQAQGQPPQIHAQ
AQQHMTAAAAQQLAMTNSLFQQQRREGMKGQCLLKLLQFSEYLSGFPGAKGKDDLSYWNAFVARFFSLNGVIRQS
LHINDTEDTTDKQYEIAYPAIARYFHTHYGSGVKSMQLVMDKGVTDRPLSGDCHCIENARASIVYWYETGCHLVA
TGTLRVQFDMEQKIDVFEFLTTGHEEYISYKRVIDAAKPAHMWFKEWHKANAQDGKQSPEMSKKSKSKQLKSPQT
QPPEVLLDLPESAVMSKGVTEAVHQFLEIVEVMGQMNPLFGFCHNNPGMAPYAALDQYVSTYISGGPPAINGQAV
PQGPRTPSFGQFGLGASPATAHMNLPGSPHIGSPAPGQMQAPGMQLQPSHQGTSSSGPSANTSPASNKRRRPSGI
IKEEEGSGAPTPSGSGPQVNGAPNRANKPPTPRIPKRVKGNTS*
Coding >Hirsu2|11055
ATGGGTCCCGGGATGCCCCCCAACGCGGCACAACAAGGCGCTCCAGGTGCCGGCATGCCTCAACAATTTGGCGCC
GGCCACATGGCCGTCTCCGGGCCTGGGGGCCAGGTCAATCCCGCCTTGATGGGCGCGATGCCACCGGGGGCCAAT
CCGCATGCCTTGCAGCATCTGACTCCTGCCCAGCAGCAGTTATTTCAGCACCAGCAGCACCAGCAGCACCAGCAG
CACCAGCAGCAGCAACTGCAAAATCAGTTCCACAACCCGAGCGCCATGGCCGCGATACGACAGCATCAACTCCTG
CAGCACCAACAACAGCAGGCCAGGCAGGCGCTGATGGCTCAGCAAGCCGTCCACGCGAATATGGCCGTCGGCAAC
GGCATTCCCATGGGCATGCCGCTCAACCCACAACAGATCCAACAGCTACGGAGCGCGGGAAGGATCGGACCGGGC
CAGCACCCACAAGCCCAGGCCATCATGGCCCAGCAACTGGCCCTGCAACAGCAGCAACAGGCACAGCAGCAGCAT
GCTGCGCAACAAGCGGCGCACAACCAGCAAATGTCGGGCGGCCCAAACCAGGGGCAACACATGCCGATGGGTGCG
CAGAACATGGCCGGCATGCAGCAGCAGAGCCAGATGGGTGGCGGCGTTCAGAACCAGATGGGCGGGCAGCAGCAG
CAGGGCGTACAGCAGGCGCCAGGCCAGCCTCAACCACAGCCTCAAGGTCAACCCCAGCAGCCTGGTCAACAGGCG
CAGCACACACCCCAACAAACGTCGCAAGCCGGGACGCCGGCCCCGAGCGGACAGCAGACGCCTTCGCAGACACCG
GCCCCTGCGCCGTCGCAGTCGAACCAGCTACAACAAGGTCAGGCACAGGGCCAGCCTCCGCAGATTCACGCCCAG
GCGCAGCAGCATATGACCGCCGCCGCCGCGCAGCAGCTGGCCATGACCAACTCCCTCTTCCAACAACAGAGGAGA
GAGGGCATGAAGGGCCAGTGTCTGCTCAAGCTCTTGCAGTTCAGCGAATATCTCAGCGGCTTCCCTGGGGCTAAG
GGCAAGGACGATCTCTCCTATTGGAACGCCTTCGTCGCTCGCTTCTTCTCTCTCAACGGTGTCATCCGACAATCG
TTGCACATCAACGACACCGAAGACACGACGGACAAGCAATACGAGATCGCGTACCCCGCCATCGCCCGATATTTC
CACACGCACTACGGAAGTGGTGTGAAGAGCATGCAGCTGGTCATGGACAAGGGGGTGACGGATCGGCCGTTATCG
GGGGACTGCCACTGTATCGAAAACGCCAGGGCCAGCATCGTGTACTGGTACGAAACGGGATGTCACCTCGTCGCT
ACGGGAACTCTGCGCGTCCAATTCGACATGGAGCAGAAGATTGACGTGTTCGAGTTTCTCACCACGGGACACGAA
GAGTACATCTCGTACAAGCGCGTCATTGACGCCGCGAAGCCCGCGCACATGTGGTTCAAGGAATGGCACAAGGCC
AACGCCCAAGACGGCAAGCAGTCTCCGGAAATGTCGAAGAAGAGCAAGTCCAAGCAGCTCAAGTCGCCGCAAACG
CAGCCGCCGGAAGTCTTGCTCGATCTCCCCGAGTCAGCCGTGATGAGCAAGGGTGTGACGGAGGCCGTGCACCAG
TTTCTCGAGATAGTCGAGGTCATGGGTCAGATGAATCCCCTGTTCGGCTTCTGCCACAATAACCCGGGCATGGCC
CCGTACGCGGCGCTGGATCAGTACGTCTCGACGTACATCAGCGGCGGGCCGCCGGCCATAAACGGCCAAGCGGTT
CCCCAGGGCCCGAGAACGCCGAGCTTCGGACAGTTCGGCTTGGGGGCCAGCCCTGCGACGGCTCACATGAACCTG
CCGGGGTCGCCGCATATCGGCAGCCCAGCGCCGGGCCAGATGCAGGCCCCGGGCATGCAGCTGCAACCAAGCCAC
CAGGGAACGAGCTCGAGCGGACCAAGTGCTAATACGTCGCCCGCATCAAACAAGCGCAGGCGGCCGTCGGGCATC
ATCAAGGAGGAGGAAGGGTCGGGGGCTCCCACTCCTTCGGGGTCCGGCCCCCAAGTGAACGGAGCGCCGAACCGG
GCCAACAAACCGCCCACTCCTCGGATTCCCAAAAGGGTCAAGGGGAATACTTCTTGA
Transcript >Hirsu2|11055
ATGGGTCCCGGGATGCCCCCCAACGCGGCACAACAAGGCGCTCCAGGTGCCGGCATGCCTCAACAATTTGGCGCC
GGCCACATGGCCGTCTCCGGGCCTGGGGGCCAGGTCAATCCCGCCTTGATGGGCGCGATGCCACCGGGGGCCAAT
CCGCATGCCTTGCAGCATCTGACTCCTGCCCAGCAGCAGTTATTTCAGCACCAGCAGCACCAGCAGCACCAGCAG
CACCAGCAGCAGCAACTGCAAAATCAGTTCCACAACCCGAGCGCCATGGCCGCGATACGACAGCATCAACTCCTG
CAGCACCAACAACAGCAGGCCAGGCAGGCGCTGATGGCTCAGCAAGCCGTCCACGCGAATATGGCCGTCGGCAAC
GGCATTCCCATGGGCATGCCGCTCAACCCACAACAGATCCAACAGCTACGGAGCGCGGGAAGGATCGGACCGGGC
CAGCACCCACAAGCCCAGGCCATCATGGCCCAGCAACTGGCCCTGCAACAGCAGCAACAGGCACAGCAGCAGCAT
GCTGCGCAACAAGCGGCGCACAACCAGCAAATGTCGGGCGGCCCAAACCAGGGGCAACACATGCCGATGGGTGCG
CAGAACATGGCCGGCATGCAGCAGCAGAGCCAGATGGGTGGCGGCGTTCAGAACCAGATGGGCGGGCAGCAGCAG
CAGGGCGTACAGCAGGCGCCAGGCCAGCCTCAACCACAGCCTCAAGGTCAACCCCAGCAGCCTGGTCAACAGGCG
CAGCACACACCCCAACAAACGTCGCAAGCCGGGACGCCGGCCCCGAGCGGACAGCAGACGCCTTCGCAGACACCG
GCCCCTGCGCCGTCGCAGTCGAACCAGCTACAACAAGGTCAGGCACAGGGCCAGCCTCCGCAGATTCACGCCCAG
GCGCAGCAGCATATGACCGCCGCCGCCGCGCAGCAGCTGGCCATGACCAACTCCCTCTTCCAACAACAGAGGAGA
GAGGGCATGAAGGGCCAGTGTCTGCTCAAGCTCTTGCAGTTCAGCGAATATCTCAGCGGCTTCCCTGGGGCTAAG
GGCAAGGACGATCTCTCCTATTGGAACGCCTTCGTCGCTCGCTTCTTCTCTCTCAACGGTGTCATCCGACAATCG
TTGCACATCAACGACACCGAAGACACGACGGACAAGCAATACGAGATCGCGTACCCCGCCATCGCCCGATATTTC
CACACGCACTACGGAAGTGGTGTGAAGAGCATGCAGCTGGTCATGGACAAGGGGGTGACGGATCGGCCGTTATCG
GGGGACTGCCACTGTATCGAAAACGCCAGGGCCAGCATCGTGTACTGGTACGAAACGGGATGTCACCTCGTCGCT
ACGGGAACTCTGCGCGTCCAATTCGACATGGAGCAGAAGATTGACGTGTTCGAGTTTCTCACCACGGGACACGAA
GAGTACATCTCGTACAAGCGCGTCATTGACGCCGCGAAGCCCGCGCACATGTGGTTCAAGGAATGGCACAAGGCC
AACGCCCAAGACGGCAAGCAGTCTCCGGAAATGTCGAAGAAGAGCAAGTCCAAGCAGCTCAAGTCGCCGCAAACG
CAGCCGCCGGAAGTCTTGCTCGATCTCCCCGAGTCAGCCGTGATGAGCAAGGGTGTGACGGAGGCCGTGCACCAG
TTTCTCGAGATAGTCGAGGTCATGGGTCAGATGAATCCCCTGTTCGGCTTCTGCCACAATAACCCGGGCATGGCC
CCGTACGCGGCGCTGGATCAGTACGTCTCGACGTACATCAGCGGCGGGCCGCCGGCCATAAACGGCCAAGCGGTT
CCCCAGGGCCCGAGAACGCCGAGCTTCGGACAGTTCGGCTTGGGGGCCAGCCCTGCGACGGCTCACATGAACCTG
CCGGGGTCGCCGCATATCGGCAGCCCAGCGCCGGGCCAGATGCAGGCCCCGGGCATGCAGCTGCAACCAAGCCAC
CAGGGAACGAGCTCGAGCGGACCAAGTGCTAATACGTCGCCCGCATCAAACAAGCGCAGGCGGCCGTCGGGCATC
ATCAAGGAGGAGGAAGGGTCGGGGGCTCCCACTCCTTCGGGGTCCGGCCCCCAAGTGAACGGAGCGCCGAACCGG
GCCAACAAACCGCCCACTCCTCGGATTCCCAAAAGGGTCAAGGGGAATACTTCTTGA
Gene >Hirsu2|11055
ATGGGTCCCGGGATGCCCCCCAACGCGGCACAACAAGGCGCTCCAGGTGCCGGCATGCCTCAACAATTTGGCGCC
GGCCACATGGCCGTCTCCGGGCCTGGGGGCCAGGTCAATCCCGCCTTGATGGGCGCGATGCCACCGGGGGCCAAT
CCGCATGCCTTGCAGCATCTGACTCCTGCCCAGCAGCAGTTATTTCAGCACCAGCAGCACCAGCAGCACCAGCAG
CACCAGCAGCAGCAACTGCAAAATCAGTGTATGCAGCCCCCTTCCCTTCGCCCACCTCCCTTCCTGTCACCTCGC
TAACACGTCTCGCTCGACGCAGTCCACAACCCGAGCGCCATGGCCGCGATACGACAGCATCAACTCCTGCAGCAC
CAACAACAGCAGGCCAGGCAGGCGCTGATGGCTCAGCAAGCCGTCCACGCGAATATGGCCGTCGGCAACGGCATT
CCCATGGGCATGCCGCTCAACCCACAACAGATCCAACAGCTACGGAGCGCGGGAAGGATCGGACCGGTGAGTGCT
CCGCCTCCGCAGTTCCGCGGCACTTCGCCTGCAGGGTTCTGCTGACTTGGAGCACGACAGGGCCAGCACCCACAA
GCCCAGGCCATCATGGCCCAGCAACTGGCCCTGCAACAGCAGCAACAGGCACAGCAGCAGCATGCTGCGCAACAA
GCGGCGCACAACCAGCAAATGTCGGGCGGCCCAAACCAGGGGCAACACATGCCGATGGGTGCGCAGAACATGGCC
GGCATGCAGCAGCAGAGCCAGATGGGTGGCGGCGTTCAGAACCAGATGGGCGGGCAGCAGCAGCAGGGCGTACAG
CAGGCGCCAGGCCAGCCTCAACCACAGCCTCAAGGTCAACCCCAGCAGCCTGGTCAACAGGCGCAGCACACACCC
CAACAAACGTCGCAAGCCGGGACGCCGGCCCCGAGCGGACAGCAGACGCCTTCGCAGACACCGGCCCCTGCGCCG
TCGCAGTCGAACCAGCTACAACAAGGTCAGGCACAGGGCCAGCCTCCGCAGATTCACGCCCAGGCGCAGCAGCAT
ATGACCGCCGCCGCCGCGCAGCAGCTGGCCATGACCAACTCCCTCTTCCAACAACAGAGGAGAGAGGGCATGAAG
GGCCAGTGTCTGCTCAAGCTCTTGCAGTTCAGCGAATATCTCAGCGGCTTCCCTGTCGGTCTCCTATCCCGTCAT
TCCAATTGAATTTCCGTCGGTGTTTGCATGGCAGACGCTAATATATAGGCTGGCTGACAGGGGGCTAAGGGCAAG
GACGATCTCTCCTATTGGAACGCCTTCGTCGCTCGCTTCTTCTCTCTCAACGGTGTCATCCGACAATCGTTGCAC
ATCAACGACACCGAAGACACGACGGACAAGCAATACGAGATCGCGTACCCCGCCATCGCCCGATATTTCCACACG
CACTACGGAAGTGGTGTGAAGAGCATGCAGCTGGTCATGGACAAGGGGGTGACGGATCGGCCGTTATCGGGGGAC
TGCCACTGTATCGAAAACGCCAGGGCCAGCATCGTGTACTGGTACGAAACGGGATGTCACGTAAGTTGCGGTGGG
CGGGTCATGAAGTGGAAGCCTATGGGGGTGAAGATGGCGACTGACCGTGCACAGCTCGTCGCTACGGGAACTCTG
CGCGTCCAATTCGACATGGAGCAGAAGATTGACGTGTTCGAGTTTCTCACCACGGGACACGAAGAGTACATCTCG
TACAAGCGCGTCATTGACGCCGCGAAGCCCGCGCACATGTGGTTCAAGGAATGGCACAAGGCCAACGCCCAAGAC
GGCAAGCAGTCTCCGGAAATGTCGAAGAAGAGCAAGTCCAAGCAGCTCAAGTCGCCGCAAACGCAGCCGCCGGAA
GTCTTGCTCGATCTCCCCGAGTCAGCCGTGATGAGCAAGGGTGTGACGGAGGCCGTGCACCAGTTTCTCGAGGTA
TGAGACATTCAAGAAACCTCCCGCATGATGGACGGATCTGACGTGACTCGAACCGCTGCAGATAGTCGAGGTCAT
GGGTCAGATGAATCCCCTGTTCGGCTTCTGCCACAATAACCCGGGCATGGCCCCGTACGCGGCGCTGGATCAGTA
CGTCTCGACGTACATCAGCGGCGGGCCGCCGGCCATAAACGGCCAAGCGGTTCCCCAGGGCCCGAGAACGCCGAG
CTTCGGACAGTTCGGCTTGGGGGCCAGCCCTGCGACGGCTCACATGAACCTGCCGGGGTCGCCGCATATCGGCAG
CCCAGCGCCGGGCCAGATGCAGGCCCCGGGCATGCAGCTGCAACCAAGCCACCAGGGAACGAGCTCGAGCGGACC
AAGTGCTAATACGTCGCCCGCATCAAACAAGCGCAGGCGGCCGTCGGGCATCATCAAGGAGGAGGAAGGGTCGGG
GGCTCCCACTCCTTCGGGGTCCGGCCCCCAAGTGAACGGAGCGCCGAACCGGGCCAACAAACCGCCCACTCCTCG
GATTCCCAAAAGGGTCAAGGGGAATACTTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail