Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11053
Gene name
LocationContig_953:7737..8386
Strand+
Gene length (bp)649
Transcript length (bp)465
Coding sequence length (bp)465
Protein length (aa) 155

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 53 75 22
3 87 106 19
4 121 143 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11053
MASSLPTVPRLVFTIVEPLSLVAGFLGAVGDPAWFAAEQVPQKVPPAVTPNGIVLALQLGNLYLLMALVGLAVLL
TTSEVKVVRRYLFALWLGDIGHVLFSCRGLGMDRLMRPAEWNAMAWGNIVMTVWLFSMRSAYFLGVFGPDKPPTR
HKSA*
Coding >Hirsu2|11053
ATGGCCTCCTCGCTTCCGACCGTGCCGCGCCTGGTCTTCACCATCGTCGAGCCCCTATCGCTCGTCGCGGGCTTT
CTCGGCGCCGTCGGTGACCCTGCCTGGTTCGCCGCGGAGCAAGTTCCTCAAAAGGTCCCGCCAGCCGTCACGCCC
AACGGCATCGTCCTGGCCCTGCAGCTGGGCAATCTGTATCTGCTCATGGCCCTCGTCGGCCTCGCAGTCCTCCTC
ACCACGTCCGAGGTCAAGGTCGTGCGCCGCTACCTGTTCGCCCTGTGGCTCGGCGACATTGGCCATGTCCTCTTC
AGCTGCCGCGGCTTGGGCATGGACCGCCTGATGAGGCCGGCCGAGTGGAATGCCATGGCCTGGGGCAACATTGTC
ATGACGGTCTGGCTCTTCTCCATGCGCTCCGCCTACTTCCTCGGTGTCTTCGGCCCCGATAAGCCGCCCACCAGG
CACAAGTCTGCATGA
Transcript >Hirsu2|11053
ATGGCCTCCTCGCTTCCGACCGTGCCGCGCCTGGTCTTCACCATCGTCGAGCCCCTATCGCTCGTCGCGGGCTTT
CTCGGCGCCGTCGGTGACCCTGCCTGGTTCGCCGCGGAGCAAGTTCCTCAAAAGGTCCCGCCAGCCGTCACGCCC
AACGGCATCGTCCTGGCCCTGCAGCTGGGCAATCTGTATCTGCTCATGGCCCTCGTCGGCCTCGCAGTCCTCCTC
ACCACGTCCGAGGTCAAGGTCGTGCGCCGCTACCTGTTCGCCCTGTGGCTCGGCGACATTGGCCATGTCCTCTTC
AGCTGCCGCGGCTTGGGCATGGACCGCCTGATGAGGCCGGCCGAGTGGAATGCCATGGCCTGGGGCAACATTGTC
ATGACGGTCTGGCTCTTCTCCATGCGCTCCGCCTACTTCCTCGGTGTCTTCGGCCCCGATAAGCCGCCCACCAGG
CACAAGTCTGCATGA
Gene >Hirsu2|11053
ATGGCCTCCTCGCTTCCGACCGTGCCGCGCCTGGTCTTCACCATCGTCGAGCCCCTATCGCTGTGAGCGAGCGCT
CCTGCACCCCCTCCCGCACGACGTGCCGGCCCGTGTGATAGCTAATTCGACGGAACAGCGTCGCGGGCTTTCTCG
GCGCCGTCGGTGACCCTGCCTGGTTCGCCGCGGAGCAAGTTCCTCAAAAGGTCCCGCCAGCCGTCACGCCCAACG
GCATCGTCCTGGCCCTGCAGCTGGGCAATCTGTATCTGCTCATGGCCCTCGTCGGCCTCGCAGTCCTCCTCACCA
CGTCCGAGGTCAAGGTCGTGCGCCGCTACCTGTTCGCCCTGTGGCTCGGCGACATTGGCCATGTCCTCTTCAGCT
GCCGCGGCTTGGGCATGGACCGCCTGATGAGGCCGGCCGAGTGGAATGCCATGGCCTGGGGCAACATTGTCATGA
CGGTGAGCCGAGCCGCCCCTCCAAATCGGACGATGCCCCGGCCATGTTCTTGGCCATGTCCCTCGACAACCCCCC
GACCCCCCGGACGATGCCACTGACGATGCCCTCGGCACAGGTCTGGCTCTTCTCCATGCGCTCCGCCTACTTCCT
CGGTGTCTTCGGCCCCGATAAGCCGCCCACCAGGCACAAGTCTGCATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail