Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11052
Gene name
LocationContig_953:5222..6941
Strand-
Gene length (bp)1719
Transcript length (bp)1719
Coding sequence length (bp)1719
Protein length (aa) 573

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 1.3E-08 230 278

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10274|TEB1_SCHPO Telobox protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=teb1 PE=1 SV=1 221 442 2.0E-14
sp|Q6C9I6|TAY1_YARLI telomere-associated protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TAY1 PE=1 SV=1 215 285 6.0E-14
sp|Q6C9I6|TAY1_YARLI telomere-associated protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TAY1 PE=1 SV=1 361 442 2.0E-09
sp|C0HIA3|SMH6_MAIZE Single myb histone 6 OS=Zea mays GN=SMH6 PE=2 SV=1 229 277 6.0E-08
sp|Q8W119|SMH4_MAIZE Single myb histone 4 OS=Zea mays GN=SMH4 PE=2 SV=1 229 292 7.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10274|TEB1_SCHPO Telobox protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=teb1 PE=1 SV=1 221 442 2.0E-14
sp|Q6C9I6|TAY1_YARLI telomere-associated protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TAY1 PE=1 SV=1 215 285 6.0E-14
sp|Q6C9I6|TAY1_YARLI telomere-associated protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TAY1 PE=1 SV=1 361 442 2.0E-09
sp|C0HIA3|SMH6_MAIZE Single myb histone 6 OS=Zea mays GN=SMH6 PE=2 SV=1 229 277 6.0E-08
sp|Q8W119|SMH4_MAIZE Single myb histone 4 OS=Zea mays GN=SMH4 PE=2 SV=1 229 292 7.0E-07
sp|Q9FJW5|TRB2_ARATH Telomere repeat-binding factor 2 OS=Arabidopsis thaliana GN=TRB2 PE=1 SV=1 229 297 7.0E-07
sp|Q9M2X3|TRB3_ARATH Telomere repeat-binding factor 3 OS=Arabidopsis thaliana GN=TRB3 PE=1 SV=1 229 348 8.0E-07
sp|Q6WLH4|SMH3_MAIZE Single myb histone 3 OS=Zea mays GN=SMH3 PE=2 SV=1 229 280 2.0E-06
sp|Q8VWK4|TRB1_ARATH Telomere repeat-binding factor 1 OS=Arabidopsis thaliana GN=TRB1 PE=1 SV=1 229 277 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11052
MATIEPRLIHLLNESTTPQIQHADLPPLYALPLPTPSERALPPLEPDASHRPDRYAVDAAAFSLSLPADDAAAIH
RKDDGRWEGRYAAASSAYPLRLLLGESDLAEPSSHTHAKILNEPMDAPDEAYNKKRARNLNVKDDFVQLPQPMKK
QKAAKQALAMPPIINGLHEPPPHAALFPPIASNSFSQAEGSQMTLLRDMGRGAEDKSITPASSDADRNANRARKR
ATKPRRKWSEEETKHLLLGVNRHGVGKWTTILEDPDFTFNDRTAGDLKDRFRTCCPVELRGAGKNSLPDSPPPPP
PREPNVKAKKGIHSENILIEADNPPPEDDNGTQPAVPPPAPPPPPPLPPQQGSETAPKQKKSRAHRKKMEDLAEL
GIHGPFKKSLRRERRPFTDQDDREILDGLDIYGPAWTKIQRDPRFHLSSRQPTDLRDRVRNKYPGVYQRIEKGTF
QTKDESRGNDILEPSIKISINDSLKRPKATTGHKSSKDEAHTWPLQMIESSGYMQPPPSFEFGEVSAPQFMGGEM
DISRLLLDDSRLGQMPARHGIDGVSGPPSPFASEHRRERPGAHTVKC*
Coding >Hirsu2|11052
ATGGCCACCATCGAGCCACGCCTCATCCATCTGCTGAATGAGTCGACGACGCCCCAGATCCAGCACGCCGACCTC
CCGCCACTCTACGCCCTGCCGCTGCCGACGCCCTCGGAGCGCGCCCTCCCGCCGCTCGAGCCCGACGCGAGCCAC
CGCCCTGACCGGTATGCCGTCGACGCGGCCGCCTTCTCGCTCTCGCTGCCCGCCGACGATGCCGCCGCCATCCAC
CGCAAGGACGACGGCCGGTGGGAGGGCCGGTACGCGGCCGCCTCGTCCGCCTACCCCCTGCGGCTGCTGTTGGGC
GAATCCGACCTGGCCGAGCCGTCCTCCCACACGCACGCCAAGATCCTCAACGAGCCGATGGATGCGCCCGACGAA
GCCTACAACAAGAAGCGAGCGCGAAACCTCAACGTCAAGGACGACTTCGTCCAGCTGCCTCAGCCGATGAAGAAG
CAAAAGGCCGCCAAGCAGGCGCTGGCCATGCCCCCCATCATCAACGGCCTGCACGAGCCTCCTCCGCACGCCGCC
CTCTTCCCGCCCATCGCCTCCAACTCCTTTAGCCAGGCCGAGGGCTCCCAGATGACGCTTCTGCGCGACATGGGC
CGCGGCGCCGAAGACAAGAGCATCACGCCCGCGTCGTCAGACGCCGACAGGAATGCGAACAGGGCCAGGAAGCGC
GCGACGAAGCCCCGGAGGAAGTGGTCCGAGGAGGAGACCAAGCATCTGCTCCTTGGTGTCAACCGCCATGGCGTC
GGGAAGTGGACCACCATCCTCGAGGACCCCGACTTCACCTTCAACGACCGCACCGCCGGCGACCTCAAGGATCGG
TTCAGGACCTGCTGCCCTGTCGAGCTTCGCGGCGCGGGCAAGAACTCGCTGCCCGACTCGCCGCCGCCGCCGCCG
CCGCGCGAGCCCAACGTCAAAGCAAAAAAGGGGATCCACTCTGAGAACATACTCATCGAGGCGGACAATCCGCCG
CCCGAGGACGACAACGGAACTCAACCGGCTGTTCCTCCTCCCGCTCCCCCCCCCCCTCCCCCGCTTCCCCCGCAG
CAAGGTTCCGAGACGGCGCCCAAGCAGAAAAAGAGCCGGGCACACCGCAAAAAGATGGAGGACCTGGCCGAGTTG
GGTATCCACGGGCCCTTCAAGAAGTCTCTCCGGCGCGAGCGGCGCCCCTTCACCGACCAGGACGATCGCGAAATC
TTGGACGGCCTCGACATCTACGGCCCCGCCTGGACCAAGATCCAGCGCGACCCCCGCTTCCACCTCTCGAGCAGG
CAGCCCACCGACCTGCGAGATCGGGTGCGGAACAAATATCCCGGCGTATACCAGCGCATCGAGAAGGGCACCTTC
CAGACCAAAGACGAGAGCCGAGGCAACGACATCCTCGAGCCTTCGATCAAGATATCGATCAACGACTCGCTCAAG
AGGCCCAAGGCGACGACGGGCCACAAGAGCTCCAAGGACGAGGCGCATACCTGGCCTCTGCAGATGATAGAGTCC
TCGGGCTACATGCAGCCTCCGCCGAGCTTCGAGTTCGGCGAGGTGAGCGCGCCCCAGTTTATGGGCGGCGAGATG
GACATTTCTAGACTTCTTCTAGACGATTCGAGGTTGGGCCAGATGCCTGCGCGACACGGCATCGACGGCGTCTCC
GGTCCGCCGTCGCCCTTCGCCTCGGAGCATCGGCGAGAACGCCCGGGGGCCCACACGGTCAAGTGCTGA
Transcript >Hirsu2|11052
ATGGCCACCATCGAGCCACGCCTCATCCATCTGCTGAATGAGTCGACGACGCCCCAGATCCAGCACGCCGACCTC
CCGCCACTCTACGCCCTGCCGCTGCCGACGCCCTCGGAGCGCGCCCTCCCGCCGCTCGAGCCCGACGCGAGCCAC
CGCCCTGACCGGTATGCCGTCGACGCGGCCGCCTTCTCGCTCTCGCTGCCCGCCGACGATGCCGCCGCCATCCAC
CGCAAGGACGACGGCCGGTGGGAGGGCCGGTACGCGGCCGCCTCGTCCGCCTACCCCCTGCGGCTGCTGTTGGGC
GAATCCGACCTGGCCGAGCCGTCCTCCCACACGCACGCCAAGATCCTCAACGAGCCGATGGATGCGCCCGACGAA
GCCTACAACAAGAAGCGAGCGCGAAACCTCAACGTCAAGGACGACTTCGTCCAGCTGCCTCAGCCGATGAAGAAG
CAAAAGGCCGCCAAGCAGGCGCTGGCCATGCCCCCCATCATCAACGGCCTGCACGAGCCTCCTCCGCACGCCGCC
CTCTTCCCGCCCATCGCCTCCAACTCCTTTAGCCAGGCCGAGGGCTCCCAGATGACGCTTCTGCGCGACATGGGC
CGCGGCGCCGAAGACAAGAGCATCACGCCCGCGTCGTCAGACGCCGACAGGAATGCGAACAGGGCCAGGAAGCGC
GCGACGAAGCCCCGGAGGAAGTGGTCCGAGGAGGAGACCAAGCATCTGCTCCTTGGTGTCAACCGCCATGGCGTC
GGGAAGTGGACCACCATCCTCGAGGACCCCGACTTCACCTTCAACGACCGCACCGCCGGCGACCTCAAGGATCGG
TTCAGGACCTGCTGCCCTGTCGAGCTTCGCGGCGCGGGCAAGAACTCGCTGCCCGACTCGCCGCCGCCGCCGCCG
CCGCGCGAGCCCAACGTCAAAGCAAAAAAGGGGATCCACTCTGAGAACATACTCATCGAGGCGGACAATCCGCCG
CCCGAGGACGACAACGGAACTCAACCGGCTGTTCCTCCTCCCGCTCCCCCCCCCCCTCCCCCGCTTCCCCCGCAG
CAAGGTTCCGAGACGGCGCCCAAGCAGAAAAAGAGCCGGGCACACCGCAAAAAGATGGAGGACCTGGCCGAGTTG
GGTATCCACGGGCCCTTCAAGAAGTCTCTCCGGCGCGAGCGGCGCCCCTTCACCGACCAGGACGATCGCGAAATC
TTGGACGGCCTCGACATCTACGGCCCCGCCTGGACCAAGATCCAGCGCGACCCCCGCTTCCACCTCTCGAGCAGG
CAGCCCACCGACCTGCGAGATCGGGTGCGGAACAAATATCCCGGCGTATACCAGCGCATCGAGAAGGGCACCTTC
CAGACCAAAGACGAGAGCCGAGGCAACGACATCCTCGAGCCTTCGATCAAGATATCGATCAACGACTCGCTCAAG
AGGCCCAAGGCGACGACGGGCCACAAGAGCTCCAAGGACGAGGCGCATACCTGGCCTCTGCAGATGATAGAGTCC
TCGGGCTACATGCAGCCTCCGCCGAGCTTCGAGTTCGGCGAGGTGAGCGCGCCCCAGTTTATGGGCGGCGAGATG
GACATTTCTAGACTTCTTCTAGACGATTCGAGGTTGGGCCAGATGCCTGCGCGACACGGCATCGACGGCGTCTCC
GGTCCGCCGTCGCCCTTCGCCTCGGAGCATCGGCGAGAACGCCCGGGGGCCCACACGGTCAAGTGCTGA
Gene >Hirsu2|11052
ATGGCCACCATCGAGCCACGCCTCATCCATCTGCTGAATGAGTCGACGACGCCCCAGATCCAGCACGCCGACCTC
CCGCCACTCTACGCCCTGCCGCTGCCGACGCCCTCGGAGCGCGCCCTCCCGCCGCTCGAGCCCGACGCGAGCCAC
CGCCCTGACCGGTATGCCGTCGACGCGGCCGCCTTCTCGCTCTCGCTGCCCGCCGACGATGCCGCCGCCATCCAC
CGCAAGGACGACGGCCGGTGGGAGGGCCGGTACGCGGCCGCCTCGTCCGCCTACCCCCTGCGGCTGCTGTTGGGC
GAATCCGACCTGGCCGAGCCGTCCTCCCACACGCACGCCAAGATCCTCAACGAGCCGATGGATGCGCCCGACGAA
GCCTACAACAAGAAGCGAGCGCGAAACCTCAACGTCAAGGACGACTTCGTCCAGCTGCCTCAGCCGATGAAGAAG
CAAAAGGCCGCCAAGCAGGCGCTGGCCATGCCCCCCATCATCAACGGCCTGCACGAGCCTCCTCCGCACGCCGCC
CTCTTCCCGCCCATCGCCTCCAACTCCTTTAGCCAGGCCGAGGGCTCCCAGATGACGCTTCTGCGCGACATGGGC
CGCGGCGCCGAAGACAAGAGCATCACGCCCGCGTCGTCAGACGCCGACAGGAATGCGAACAGGGCCAGGAAGCGC
GCGACGAAGCCCCGGAGGAAGTGGTCCGAGGAGGAGACCAAGCATCTGCTCCTTGGTGTCAACCGCCATGGCGTC
GGGAAGTGGACCACCATCCTCGAGGACCCCGACTTCACCTTCAACGACCGCACCGCCGGCGACCTCAAGGATCGG
TTCAGGACCTGCTGCCCTGTCGAGCTTCGCGGCGCGGGCAAGAACTCGCTGCCCGACTCGCCGCCGCCGCCGCCG
CCGCGCGAGCCCAACGTCAAAGCAAAAAAGGGGATCCACTCTGAGAACATACTCATCGAGGCGGACAATCCGCCG
CCCGAGGACGACAACGGAACTCAACCGGCTGTTCCTCCTCCCGCTCCCCCCCCCCCTCCCCCGCTTCCCCCGCAG
CAAGGTTCCGAGACGGCGCCCAAGCAGAAAAAGAGCCGGGCACACCGCAAAAAGATGGAGGACCTGGCCGAGTTG
GGTATCCACGGGCCCTTCAAGAAGTCTCTCCGGCGCGAGCGGCGCCCCTTCACCGACCAGGACGATCGCGAAATC
TTGGACGGCCTCGACATCTACGGCCCCGCCTGGACCAAGATCCAGCGCGACCCCCGCTTCCACCTCTCGAGCAGG
CAGCCCACCGACCTGCGAGATCGGGTGCGGAACAAATATCCCGGCGTATACCAGCGCATCGAGAAGGGCACCTTC
CAGACCAAAGACGAGAGCCGAGGCAACGACATCCTCGAGCCTTCGATCAAGATATCGATCAACGACTCGCTCAAG
AGGCCCAAGGCGACGACGGGCCACAAGAGCTCCAAGGACGAGGCGCATACCTGGCCTCTGCAGATGATAGAGTCC
TCGGGCTACATGCAGCCTCCGCCGAGCTTCGAGTTCGGCGAGGTGAGCGCGCCCCAGTTTATGGGCGGCGAGATG
GACATTTCTAGACTTCTTCTAGACGATTCGAGGTTGGGCCAGATGCCTGCGCGACACGGCATCGACGGCGTCTCC
GGTCCGCCGTCGCCCTTCGCCTCGGAGCATCGGCGAGAACGCCCGGGGGCCCACACGGTCAAGTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail