Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11042
Gene name
LocationContig_951:5470..7449
Strand-
Gene length (bp)1979
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00118 Cpn60_TCP1 TCP-1/cpn60 chaperonin family 1.4E-163 30 527

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94515|TCPZ_SCHPO T-complex protein 1 subunit zeta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct6 PE=3 SV=1 6 535 0.0E+00
sp|P39079|TCPZ_YEAST T-complex protein 1 subunit zeta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT6 PE=1 SV=1 5 526 0.0E+00
sp|P80317|TCPZ_MOUSE T-complex protein 1 subunit zeta OS=Mus musculus GN=Cct6a PE=1 SV=3 1 526 0.0E+00
sp|Q3MHL7|TCPZ_BOVIN T-complex protein 1 subunit zeta OS=Bos taurus GN=CCT6A PE=1 SV=3 1 526 0.0E+00
sp|P40227|TCPZ_HUMAN T-complex protein 1 subunit zeta OS=Homo sapiens GN=CCT6A PE=1 SV=3 1 526 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94515|TCPZ_SCHPO T-complex protein 1 subunit zeta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct6 PE=3 SV=1 6 535 0.0E+00
sp|P39079|TCPZ_YEAST T-complex protein 1 subunit zeta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT6 PE=1 SV=1 5 526 0.0E+00
sp|P80317|TCPZ_MOUSE T-complex protein 1 subunit zeta OS=Mus musculus GN=Cct6a PE=1 SV=3 1 526 0.0E+00
sp|Q3MHL7|TCPZ_BOVIN T-complex protein 1 subunit zeta OS=Bos taurus GN=CCT6A PE=1 SV=3 1 526 0.0E+00
sp|P40227|TCPZ_HUMAN T-complex protein 1 subunit zeta OS=Homo sapiens GN=CCT6A PE=1 SV=3 1 526 0.0E+00
sp|Q5RCD2|TCPZ_PONAB T-complex protein 1 subunit zeta OS=Pongo abelii GN=CCT6 PE=2 SV=3 1 526 0.0E+00
sp|O77622|TCPZ_RABIT T-complex protein 1 subunit zeta OS=Oryctolagus cuniculus GN=CCT6 PE=1 SV=3 1 526 0.0E+00
sp|Q8L7N0|TCPZB_ARATH T-complex protein 1 subunit zeta 2 OS=Arabidopsis thaliana GN=CCT6B PE=1 SV=1 3 526 0.0E+00
sp|Q5ZJ54|TCPZ_CHICK T-complex protein 1 subunit zeta OS=Gallus gallus GN=CCT6 PE=1 SV=3 3 526 0.0E+00
sp|Q9M888|TCPZA_ARATH T-complex protein 1 subunit zeta 1 OS=Arabidopsis thaliana GN=CCT6A PE=1 SV=1 3 526 0.0E+00
sp|Q3T084|TCPW_BOVIN T-complex protein 1 subunit zeta-2 OS=Bos taurus GN=CCT6B PE=2 SV=3 1 526 0.0E+00
sp|P46550|TCPZ_CAEEL T-complex protein 1 subunit zeta OS=Caenorhabditis elegans GN=cct-6 PE=1 SV=1 1 526 0.0E+00
sp|Q76NU3|TCPZ_DICDI T-complex protein 1 subunit zeta OS=Dictyostelium discoideum GN=cct6 PE=1 SV=1 11 537 0.0E+00
sp|Q92526|TCPW_HUMAN T-complex protein 1 subunit zeta-2 OS=Homo sapiens GN=CCT6B PE=1 SV=5 1 526 0.0E+00
sp|Q61390|TCPW_MOUSE T-complex protein 1 subunit zeta-2 OS=Mus musculus GN=Cct6b PE=1 SV=4 1 526 0.0E+00
sp|Q9YDK6|THSA_AERPE Thermosome subunit alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=thsA PE=3 SV=2 18 526 3.0E-99
sp|O57762|THS_PYRHO Thermosome subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ths PE=3 SV=1 6 526 5.0E-97
sp|O26885|THSB_METTH Thermosome subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=thsB PE=3 SV=1 6 526 8.0E-97
sp|O26320|THSA_METTH Thermosome subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=thsA PE=3 SV=2 9 527 9.0E-97
sp|Q9V2Q7|THS_PYRAB Thermosome subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ths PE=3 SV=1 6 529 2.0E-96
sp|O28821|THSB_ARCFU Thermosome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thsB PE=3 SV=1 18 527 9.0E-96
sp|Q52500|THSB_THEKO Thermosome subunit beta OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=thsB PE=3 SV=1 9 540 4.0E-95
sp|O24730|THSB_THEK1 Thermosome subunit beta OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=thsB PE=3 SV=2 9 540 2.0E-94
sp|Q53546|THS_DESSY Thermosome subunit OS=Desulfurococcus sp. (strain SY) GN=ths PE=3 SV=1 9 531 4.0E-94
sp|Q9YA66|THSB_AERPE Thermosome subunit beta OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=thsB PE=3 SV=2 18 526 4.0E-93
sp|Q9V2T3|THSB_DESMO Thermosome subunit beta (Fragment) OS=Desulfurococcus mobilis GN=thsB PE=3 SV=1 18 518 3.0E-92
sp|P28488|THSB_SULSH Thermosome subunit beta OS=Sulfolobus shibatae GN=thsB PE=1 SV=1 13 538 1.0E-91
sp|P61111|THSA_THEKO Thermosome subunit alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=thsA PE=1 SV=1 9 527 3.0E-91
sp|P61112|THSA_THEK1 Thermosome subunit alpha OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=thsA PE=1 SV=1 9 527 3.0E-91
sp|O24732|THSB_THEK8 Thermosome subunit beta OS=Thermococcus sp. (strain KS-8) GN=thsB PE=3 SV=1 9 540 1.0E-90
sp|O93624|THS_METTL Thermosome subunit OS=Methanothermococcus thermolithotrophicus GN=ths PE=1 SV=1 18 529 1.0E-90
sp|Q58405|THS_METJA Thermosome subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ths PE=3 SV=1 18 529 1.0E-90
sp|Q9V2T8|THSB_SULSO Thermosome subunit beta OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsB PE=3 SV=2 13 537 4.0E-90
sp|O24731|THSA_THEK8 Thermosome subunit alpha OS=Thermococcus sp. (strain KS-8) GN=thsA PE=3 SV=1 9 540 6.0E-89
sp|P48424|THSA_THEAC Thermosome subunit alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=thsA PE=1 SV=1 14 528 4.0E-88
sp|P50016|THS_METKA Thermosome subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=ths PE=3 SV=1 6 531 5.0E-88
sp|P46219|THSA_SULSH Thermosome subunit alpha OS=Sulfolobus shibatae GN=thsA PE=1 SV=1 1 526 1.0E-87
sp|Q9V2S9|THSA_SULSO Thermosome subunit alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsA PE=3 SV=2 1 536 4.0E-87
sp|O30561|THS1_HALVD Thermosome subunit 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct1 PE=1 SV=1 18 526 4.0E-87
sp|O28045|THSA_ARCFU Thermosome subunit alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thsA PE=3 SV=1 18 527 1.0E-86
sp|Q9V2T5|THSA_SULAC Thermosome subunit alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=thsA PE=3 SV=2 1 529 6.0E-86
sp|Q9V2T4|THSB_SULAC Thermosome subunit beta OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=thsB PE=3 SV=2 13 526 4.0E-85
sp|O24735|THSB_SULTO Thermosome subunit beta OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=thsB PE=1 SV=1 13 526 1.0E-84
sp|O24734|THSA_SULTO Thermosome subunit alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=thsA PE=1 SV=1 2 526 1.0E-80
sp|O30560|THS2_HALVD Thermosome subunit 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct2 PE=1 SV=1 6 533 3.0E-80
sp|P48425|THSB_THEAC Thermosome subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=thsB PE=1 SV=1 18 524 5.0E-78
sp|Q9HN70|THSA_HALSA Thermosome subunit alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=thsA PE=3 SV=2 14 526 4.0E-77
sp|Q5NVF9|TCPG_PONAB T-complex protein 1 subunit gamma OS=Pongo abelii GN=CCT3 PE=2 SV=1 8 540 3.0E-74
sp|Q6P502|TCPG_RAT T-complex protein 1 subunit gamma OS=Rattus norvegicus GN=Cct3 PE=1 SV=1 8 540 4.0E-74
sp|P80318|TCPG_MOUSE T-complex protein 1 subunit gamma OS=Mus musculus GN=Cct3 PE=1 SV=1 8 540 4.0E-74
sp|P49368|TCPG_HUMAN T-complex protein 1 subunit gamma OS=Homo sapiens GN=CCT3 PE=1 SV=4 8 540 6.0E-74
sp|Q3T0K2|TCPG_BOVIN T-complex protein 1 subunit gamma OS=Bos taurus GN=CCT3 PE=1 SV=1 8 540 8.0E-74
sp|Q4R963|TCPG_MACFA T-complex protein 1 subunit gamma OS=Macaca fascicularis GN=CCT3 PE=2 SV=1 8 540 9.0E-74
sp|P50143|TCPG_XENLA T-complex protein 1 subunit gamma OS=Xenopus laevis GN=cct3 PE=2 SV=2 8 528 2.0E-70
sp|O74341|TCPG_SCHPO T-complex protein 1 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct3 PE=1 SV=1 23 524 9.0E-70
sp|P17987|TCPA_HUMAN T-complex protein 1 subunit alpha OS=Homo sapiens GN=TCP1 PE=1 SV=1 14 525 4.0E-69
sp|Q4R5G2|TCPA_MACFA T-complex protein 1 subunit alpha OS=Macaca fascicularis GN=TCP1 PE=2 SV=1 14 525 7.0E-69
sp|P18279|TCPA_CRIGR T-complex protein 1 subunit alpha OS=Cricetulus griseus GN=TCP1 PE=2 SV=1 14 525 3.0E-68
sp|Q32L40|TCPA_BOVIN T-complex protein 1 subunit alpha OS=Bos taurus GN=TCP1 PE=1 SV=1 14 525 4.0E-67
sp|Q9XT06|TCPA_MONDO T-complex protein 1 subunit alpha OS=Monodelphis domestica GN=TCP1 PE=2 SV=1 14 525 6.0E-67
sp|P28480|TCPA_RAT T-complex protein 1 subunit alpha OS=Rattus norvegicus GN=Tcp1 PE=1 SV=1 14 525 7.0E-67
sp|P11983|TCPA_MOUSE T-complex protein 1 subunit alpha OS=Mus musculus GN=Tcp1 PE=1 SV=3 14 525 1.0E-66
sp|Q84WV1|TCPG_ARATH T-complex protein 1 subunit gamma OS=Arabidopsis thaliana GN=CCT3 PE=1 SV=1 11 537 1.0E-65
sp|P54409|TCPH_TETPY T-complex protein 1 subunit eta OS=Tetrahymena pyriformis PE=3 SV=1 23 541 1.0E-65
sp|Q9LV21|TCPD_ARATH T-complex protein 1 subunit delta OS=Arabidopsis thaliana GN=CCT4 PE=1 SV=1 10 527 2.0E-65
sp|O00782|TCPG_OXYGR T-complex protein 1 subunit gamma OS=Oxytricha granulifera PE=3 SV=1 2 534 1.0E-64
sp|Q54TH8|TCPG_DICDI T-complex protein 1 subunit gamma OS=Dictyostelium discoideum GN=cct3 PE=1 SV=1 6 526 2.0E-64
sp|Q9W790|TCPA_PALPA T-complex protein 1 subunit alpha OS=Paleosuchus palpebrosus GN=TCP1 PE=2 SV=1 23 525 2.0E-64
sp|Q9V2T7|THSG_SULSO Thermosome subunit gamma OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsC PE=3 SV=1 4 524 3.0E-64
sp|Q9LKI7|TCPG_THAWE T-complex protein 1 subunit gamma OS=Thalassiosira weissflogii PE=2 SV=1 1 524 4.0E-64
sp|Q7TPB1|TCPD_RAT T-complex protein 1 subunit delta OS=Rattus norvegicus GN=Cct4 PE=1 SV=3 23 527 6.0E-64
sp|P48605|TCPG_DROME T-complex protein 1 subunit gamma OS=Drosophila melanogaster GN=Cctgamma PE=2 SV=2 8 537 8.0E-64
sp|P53451|TCPD_TAKRU T-complex protein 1 subunit delta OS=Takifugu rubripes GN=cct4 PE=2 SV=1 23 527 1.0E-63
sp|Q2T9X2|TCPD_BOVIN T-complex protein 1 subunit delta OS=Bos taurus GN=CCT4 PE=1 SV=3 23 527 2.0E-63
sp|P39077|TCPG_YEAST T-complex protein 1 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT3 PE=1 SV=2 1 524 5.0E-63
sp|P80315|TCPD_MOUSE T-complex protein 1 subunit delta OS=Mus musculus GN=Cct4 PE=1 SV=3 23 527 1.0E-62
sp|Q5R637|TCPD_PONAB T-complex protein 1 subunit delta OS=Pongo abelii GN=CCT4 PE=2 SV=3 23 527 1.0E-62
sp|P50991|TCPD_HUMAN T-complex protein 1 subunit delta OS=Homo sapiens GN=CCT4 PE=1 SV=4 23 527 2.0E-62
sp|Q9HHA2|THS3_HALVD Thermosome subunit 3 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct3 PE=1 SV=2 23 527 8.0E-62
sp|P47208|TCPD_CAEEL T-complex protein 1 subunit delta OS=Caenorhabditis elegans GN=cct-4 PE=2 SV=1 35 526 2.0E-61
sp|Q9HNI0|THSB_HALSA Thermosome subunit beta OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=thsB PE=3 SV=2 6 526 5.0E-61
sp|Q54TD3|TCPE_DICDI T-complex protein 1 subunit epsilon OS=Dictyostelium discoideum GN=cct5 PE=3 SV=1 10 540 5.0E-61
sp|P12612|TCPA_YEAST T-complex protein 1 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCP1 PE=1 SV=2 23 545 1.0E-60
sp|O15891|TCPA_TETPY T-complex protein 1 subunit alpha OS=Tetrahymena pyriformis PE=3 SV=1 14 525 2.0E-60
sp|O04450|TCPE_ARATH T-complex protein 1 subunit epsilon OS=Arabidopsis thaliana GN=CCT5 PE=1 SV=1 12 524 2.0E-60
sp|P41988|TCPA_CAEEL T-complex protein 1 subunit alpha OS=Caenorhabditis elegans GN=cct-1 PE=3 SV=2 14 534 9.0E-60
sp|P47209|TCPE_CAEEL T-complex protein 1 subunit epsilon OS=Caenorhabditis elegans GN=cct-5 PE=2 SV=1 18 523 1.0E-59
sp|O77323|TCPH_PLAF7 T-complex protein 1 subunit eta OS=Plasmodium falciparum (isolate 3D7) GN=MAL3P3.6 PE=3 SV=1 23 535 1.0E-59
sp|Q9HH21|THSG_SULSH Thermosome subunit gamma OS=Sulfolobus shibatae GN=thsC PE=3 SV=1 4 524 2.0E-59
sp|O94501|TCPA_SCHPO T-complex protein 1 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct1 PE=3 SV=1 23 473 2.0E-59
sp|Q9NB32|TCPD_OCHTR T-complex protein 1 subunit delta OS=Ochlerotatus triseriatus PE=2 SV=1 23 528 5.0E-59
sp|P80313|TCPH_MOUSE T-complex protein 1 subunit eta OS=Mus musculus GN=Cct7 PE=1 SV=1 6 525 5.0E-59
sp|Q54CL2|TCPD_DICDI T-complex protein 1 subunit delta OS=Dictyostelium discoideum GN=cct4 PE=3 SV=1 12 527 6.0E-59
sp|Q2NKZ1|TCPH_BOVIN T-complex protein 1 subunit eta OS=Bos taurus GN=CCT7 PE=1 SV=1 6 525 8.0E-59
sp|P54411|TCPE2_AVESA T-complex protein 1 subunit epsilon OS=Avena sativa PE=2 SV=1 12 524 1.0E-58
sp|P12613|TCPA_DROME T-complex protein 1 subunit alpha OS=Drosophila melanogaster GN=T-cp1 PE=2 SV=2 11 533 2.0E-58
sp|Q6C100|TCPD_YARLI T-complex protein 1 subunit delta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCT4 PE=3 SV=1 18 527 3.0E-58
sp|Q9UTM4|TCPE_SCHPO T-complex protein 1 subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct5 PE=3 SV=1 12 486 3.0E-58
sp|Q99832|TCPH_HUMAN T-complex protein 1 subunit eta OS=Homo sapiens GN=CCT7 PE=1 SV=2 6 525 4.0E-58
sp|Q5R5C8|TCPH_PONAB T-complex protein 1 subunit eta OS=Pongo abelii GN=CCT7 PE=2 SV=1 6 525 6.0E-58
sp|Q5ZJK8|TCPH_CHICK T-complex protein 1 subunit eta OS=Gallus gallus GN=CCT7 PE=1 SV=1 23 525 7.0E-58
sp|Q55BM4|TCPA_DICDI T-complex protein 1 subunit alpha OS=Dictyostelium discoideum GN=tcp1 PE=2 SV=1 23 473 9.0E-57
sp|Q94757|TCPA_SCHMA T-complex protein 1 subunit alpha OS=Schistosoma mansoni GN=TCP-1A PE=2 SV=1 14 543 1.0E-56
sp|Q4R6V2|TCPE_MACFA T-complex protein 1 subunit epsilon OS=Macaca fascicularis GN=CCT5 PE=2 SV=1 12 459 2.0E-56
sp|P48643|TCPE_HUMAN T-complex protein 1 subunit epsilon OS=Homo sapiens GN=CCT5 PE=1 SV=1 12 459 2.0E-56
sp|P54408|TCPG_TETPY T-complex protein 1 subunit gamma OS=Tetrahymena pyriformis PE=3 SV=1 8 543 4.0E-56
sp|Q5RF02|TCPE_PONAB T-complex protein 1 subunit epsilon OS=Pongo abelii GN=CCT5 PE=2 SV=1 12 459 1.0E-55
sp|P28769|TCPA_ARATH T-complex protein 1 subunit alpha OS=Arabidopsis thaliana GN=CCT1 PE=1 SV=1 14 533 2.0E-55
sp|P80316|TCPE_MOUSE T-complex protein 1 subunit epsilon OS=Mus musculus GN=Cct5 PE=1 SV=1 12 459 3.0E-55
sp|Q68FQ0|TCPE_RAT T-complex protein 1 subunit epsilon OS=Rattus norvegicus GN=Cct5 PE=1 SV=1 12 459 3.0E-55
sp|Q54ES9|TCPB_DICDI T-complex protein 1 subunit beta OS=Dictyostelium discoideum GN=cct2 PE=1 SV=1 6 526 6.0E-55
sp|Q54ER7|TCPH_DICDI T-complex protein 1 subunit eta OS=Dictyostelium discoideum GN=cct7 PE=3 SV=1 23 540 3.0E-54
sp|P40412|TCPE1_AVESA T-complex protein 1 subunit epsilon OS=Avena sativa PE=2 SV=1 33 524 4.0E-54
sp|P87153|TCPH_SCHPO Probable T-complex protein 1 subunit eta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct7 PE=1 SV=1 12 525 1.0E-53
sp|Q940P8|TCPB_ARATH T-complex protein 1 subunit beta OS=Arabidopsis thaliana GN=CCT2 PE=1 SV=1 13 524 2.0E-53
sp|P50999|TCPD_SCHPO T-complex protein 1 subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct4 PE=2 SV=2 1 527 3.0E-53
sp|P42943|TCPH_YEAST T-complex protein 1 subunit eta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT7 PE=1 SV=1 13 539 9.0E-53
sp|Q9SF16|TCPH_ARATH T-complex protein 1 subunit eta OS=Arabidopsis thaliana GN=CCT7 PE=1 SV=1 6 525 4.0E-52
sp|Q6FQT2|TCPD_CANGA T-complex protein 1 subunit delta OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CCT4 PE=3 SV=1 18 527 4.0E-52
sp|Q8SR76|TCPG_ENCCU T-complex protein 1 subunit gamma OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT3 PE=1 SV=1 26 528 4.0E-52
sp|P40413|TCPE_YEAST T-complex protein 1 subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT5 PE=1 SV=3 14 484 2.0E-50
sp|P47207|TCPB_CAEEL T-complex protein 1 subunit beta OS=Caenorhabditis elegans GN=cct-2 PE=1 SV=2 1 531 8.0E-49
sp|Q10147|TCPB_SCHPO Probable T-complex protein 1 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct2 PE=3 SV=1 14 526 9.0E-49
sp|Q4R6F8|TCPB_MACFA T-complex protein 1 subunit beta OS=Macaca fascicularis GN=CCT2 PE=2 SV=3 1 526 1.0E-48
sp|P78371|TCPB_HUMAN T-complex protein 1 subunit beta OS=Homo sapiens GN=CCT2 PE=1 SV=4 1 526 1.0E-48
sp|P39078|TCPD_YEAST T-complex protein 1 subunit delta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT4 PE=1 SV=2 18 527 1.0E-48
sp|Q3ZBH0|TCPB_BOVIN T-complex protein 1 subunit beta OS=Bos taurus GN=CCT2 PE=1 SV=3 1 526 2.0E-48
sp|P80314|TCPB_MOUSE T-complex protein 1 subunit beta OS=Mus musculus GN=Cct2 PE=1 SV=4 1 526 4.0E-48
sp|Q5XIM9|TCPB_RAT T-complex protein 1 subunit beta OS=Rattus norvegicus GN=Cct2 PE=1 SV=3 1 526 4.0E-48
sp|Q552J0|TCPQ_DICDI T-complex protein 1 subunit theta OS=Dictyostelium discoideum GN=cct8 PE=3 SV=1 16 544 2.0E-47
sp|P39076|TCPB_YEAST T-complex protein 1 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT2 PE=1 SV=1 13 527 5.0E-47
sp|Q75A36|TCPD_ASHGO T-complex protein 1 subunit delta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CCT4 PE=3 SV=1 18 527 2.0E-46
sp|Q6CL82|TCPD_KLULA T-complex protein 1 subunit delta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCT4 PE=3 SV=1 18 476 4.0E-46
sp|Q29236|TCPZ_PIG T-complex protein 1 subunit zeta (Fragment) OS=Sus scrofa GN=CCT6 PE=2 SV=1 19 119 5.0E-46
sp|Q8SRP9|TCPE_ENCCU T-complex protein 1 subunit epsilon OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT5 PE=1 SV=1 3 461 8.0E-45
sp|Q6BXF6|TCPD_DEBHA T-complex protein 1 subunit delta OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCT4 PE=3 SV=1 18 527 3.0E-44
sp|Q8SSC9|TCPA_ENCCU T-complex protein 1 subunit alpha OS=Encephalitozoon cuniculi (strain GB-M1) GN=TCP1 PE=1 SV=1 1 469 6.0E-43
sp|Q8SQP2|TCPB_ENCCU T-complex protein 1 subunit beta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT2 PE=1 SV=1 13 527 4.0E-42
sp|Q94K05|TCPQ_ARATH T-complex protein 1 subunit theta OS=Arabidopsis thaliana GN=CCT8 PE=1 SV=1 18 535 2.0E-41
sp|P54410|TCPH_TETTH T-complex protein 1 subunit eta (Fragment) OS=Tetrahymena thermophila PE=3 SV=1 59 414 1.0E-40
sp|A8X6I9|TCPQ_CAEBR T-complex protein 1 subunit theta OS=Caenorhabditis briggsae GN=cct-8 PE=3 SV=1 18 537 7.0E-39
sp|P47828|TCPQ_CANAX T-complex protein 1 subunit theta OS=Candida albicans GN=CCT8 PE=3 SV=2 19 535 1.0E-38
sp|Q8SR53|TCPH_ENCCU T-complex protein 1 subunit eta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT7 PE=1 SV=1 23 528 5.0E-38
sp|P47079|TCPQ_YEAST T-complex protein 1 subunit theta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT8 PE=1 SV=1 30 544 1.0E-37
sp|Q9N358|TCPQ_CAEEL T-complex protein 1 subunit theta OS=Caenorhabditis elegans GN=cct-8 PE=1 SV=3 18 537 6.0E-37
sp|P78921|TCPQ_SCHPO Probable T-complex protein 1 subunit theta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct8 PE=2 SV=3 18 524 2.0E-36
sp|Q6EE31|TCPQ_CHICK T-complex protein 1 subunit theta OS=Gallus gallus GN=CCT8 PE=1 SV=3 18 545 8.0E-33
sp|Q5RAP1|TCPQ_PONAB T-complex protein 1 subunit theta OS=Pongo abelii GN=CCT8 PE=2 SV=3 18 537 3.0E-32
sp|P50990|TCPQ_HUMAN T-complex protein 1 subunit theta OS=Homo sapiens GN=CCT8 PE=1 SV=4 18 537 3.0E-32
sp|Q4R5J0|TCPQ_MACFA T-complex protein 1 subunit theta OS=Macaca fascicularis GN=CCT8 PE=2 SV=1 18 537 7.0E-32
sp|P42932|TCPQ_MOUSE T-complex protein 1 subunit theta OS=Mus musculus GN=Cct8 PE=1 SV=3 18 537 2.0E-31
sp|Q3ZCI9|TCPQ_BOVIN T-complex protein 1 subunit theta OS=Bos taurus GN=CCT8 PE=1 SV=3 18 545 2.0E-31
sp|Q8SSH3|TCPD_ENCCU T-complex protein 1 subunit delta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT4 PE=1 SV=1 26 528 7.0E-26
sp|Q96SF2|TCPQM_HUMAN T-complex protein 1 subunit theta-like 2 OS=Homo sapiens GN=CCT8L2 PE=2 SV=2 30 528 8.0E-24
sp|A6NM43|TCPQL_HUMAN Putative T-complex protein 1 subunit theta-like 1 OS=Homo sapiens GN=CCT8L1P PE=5 SV=1 30 528 5.0E-23
sp|Q29068|TCPG_PIG T-complex protein 1 subunit gamma (Fragment) OS=Sus scrofa GN=CCT3 PE=2 SV=1 25 106 2.0E-16
sp|P50157|TCPA_AMBME T-complex protein 1 subunit alpha (Fragment) OS=Ambystoma mexicanum PE=2 SV=1 387 525 3.0E-13
sp|Q7UM99|CH601_RHOBA 60 kDa chaperonin 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=groL1 PE=3 SV=2 26 524 3.0E-13
sp|B1LVA0|CH60_METRJ 60 kDa chaperonin OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=groL PE=3 SV=1 30 524 2.0E-12
sp|Q8SS33|TCPQ_ENCCU T-complex protein 1 subunit theta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT8 PE=1 SV=1 32 416 6.0E-11
sp|A6U901|CH603_SINMW 60 kDa chaperonin 3 OS=Sinorhizobium medicae (strain WSM419) GN=groL3 PE=3 SV=1 30 540 8.0E-11
sp|Q7WVY0|CH602_ANASL 60 kDa chaperonin 2 OS=Anabaena sp. (strain L31) GN=groL2 PE=1 SV=1 4 524 2.0E-10
sp|Q8R5X7|CH60_FUSNN 60 kDa chaperonin OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=groL PE=3 SV=1 4 134 4.0E-10
sp|Q8GJ00|CH60_FUSNP 60 kDa chaperonin OS=Fusobacterium nucleatum subsp. polymorphum GN=groL PE=3 SV=1 4 134 6.0E-10
sp|Q3ADX3|CH60_CARHZ 60 kDa chaperonin OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=groL PE=3 SV=1 1 231 7.0E-10
sp|Q5WJN4|CH60_BACSK 60 kDa chaperonin OS=Bacillus clausii (strain KSM-K16) GN=groL PE=3 SV=1 30 231 8.0E-10
sp|Q93N35|CH60_BUCRM 60 kDa chaperonin OS=Buchnera aphidicola subsp. Rhopalosiphum maidis GN=groL PE=3 SV=1 11 231 8.0E-10
sp|C0Z361|CPNB3_ARATH Chaperonin 60 subunit beta 3, chloroplastic OS=Arabidopsis thaliana GN=CPN60B3 PE=1 SV=1 15 234 8.0E-10
sp|Q93N34|CH60_BUCRP 60 kDa chaperonin OS=Buchnera aphidicola subsp. Rhopalosiphum padi GN=groL PE=3 SV=1 30 231 9.0E-10
sp|Q59177|CH60_BUCAP 60 kDa chaperonin OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=groL PE=3 SV=3 30 231 9.0E-10
sp|O51832|CH60_BUCMP 60 kDa chaperonin OS=Buchnera aphidicola subsp. Myzus persicae GN=groL PE=3 SV=1 30 231 9.0E-10
sp|P08927|RUBB_PEA RuBisCO large subunit-binding protein subunit beta, chloroplastic OS=Pisum sativum PE=1 SV=2 15 248 1.0E-09
sp|Q11LG4|CH601_CHESB 60 kDa chaperonin 1 OS=Chelativorans sp. (strain BNC1) GN=groL1 PE=3 SV=1 30 231 1.0E-09
sp|A6LQ87|CH60_CLOB8 60 kDa chaperonin OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=groL PE=3 SV=1 17 231 1.0E-09
sp|Q8KJ24|CH60_CLOBO 60 kDa chaperonin OS=Clostridium botulinum GN=groL PE=3 SV=1 17 231 2.0E-09
sp|O50305|CH60_BACHD 60 kDa chaperonin OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=groL PE=2 SV=2 30 231 2.0E-09
sp|B8D6T6|CH60_BUCAT 60 kDa chaperonin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=groL PE=3 SV=1 30 231 2.0E-09
sp|P25750|CH60_BUCAI 60 kDa chaperonin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=groL PE=3 SV=1 30 231 2.0E-09
sp|B8D8I2|CH60_BUCA5 60 kDa chaperonin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=groL PE=3 SV=1 30 231 2.0E-09
sp|B0TCA0|CH60_HELMI 60 kDa chaperonin OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=groL PE=3 SV=1 4 231 2.0E-09
sp|Q8KIX0|CH60_BUCCM 60 kDa chaperonin OS=Buchnera aphidicola subsp. Chaetophorus leucomelas GN=groL PE=3 SV=1 13 234 2.0E-09
sp|B2A5V3|CH60_NATTJ 60 kDa chaperonin OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=groL PE=3 SV=1 30 231 3.0E-09
sp|Q07201|CH60_GEOSE 60 kDa chaperonin OS=Geobacillus stearothermophilus GN=groL PE=2 SV=1 30 231 3.0E-09
sp|Q058F3|CH60_BUCCC 60 kDa chaperonin OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=groL PE=3 SV=1 30 234 3.0E-09
sp|Q65MZ8|CH60_BACLD 60 kDa chaperonin OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=groL PE=3 SV=1 30 231 3.0E-09
sp|B9K1Y8|CH60_AGRVS 60 kDa chaperonin OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=groL PE=3 SV=1 30 231 3.0E-09
sp|B2UZ02|CH60_CLOBA 60 kDa chaperonin OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=groL PE=3 SV=1 17 231 3.0E-09
sp|A9HK37|CH601_GLUDA 60 kDa chaperonin 1 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=groL1 PE=3 SV=1 30 528 3.0E-09
sp|A8FAG3|CH60_BACP2 60 kDa chaperonin OS=Bacillus pumilus (strain SAFR-032) GN=groL PE=3 SV=1 30 231 3.0E-09
sp|Q8YVS8|CH602_NOSS1 60 kDa chaperonin 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=groL2 PE=3 SV=1 4 198 4.0E-09
sp|P22034|CH602_SYNY3 60 kDa chaperonin 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=groL2 PE=1 SV=4 4 208 4.0E-09
sp|Q8KIX3|CH60_BUCTC 60 kDa chaperonin OS=Buchnera aphidicola subsp. Tetraneura caerulescens GN=groL PE=3 SV=1 11 234 5.0E-09
sp|Q89DA6|CH607_BRADU 60 kDa chaperonin 7 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=groL7 PE=3 SV=1 30 231 5.0E-09
sp|Q6NF74|CH602_CORDI 60 kDa chaperonin 2 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=groL2 PE=3 SV=1 12 146 5.0E-09
sp|P26209|CH60_BACP3 60 kDa chaperonin OS=Bacillus sp. (strain PS3) GN=groL PE=3 SV=1 30 231 6.0E-09
sp|P21240|CPNB1_ARATH Chaperonin 60 subunit beta 1, chloroplastic OS=Arabidopsis thaliana GN=CPN60B1 PE=1 SV=3 24 234 6.0E-09
sp|Q8VV84|CH60_GEOTM 60 kDa chaperonin OS=Geobacillus thermoglucosidasius GN=groL PE=3 SV=1 30 231 6.0E-09
sp|Q3M6L5|CH602_ANAVT 60 kDa chaperonin 2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=groL2 PE=3 SV=2 4 198 6.0E-09
sp|B2TIX0|CH60_CLOBB 60 kDa chaperonin OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=groL PE=3 SV=1 17 157 6.0E-09
sp|Q2Y6I6|CH60_NITMU 60 kDa chaperonin OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=groL PE=3 SV=1 30 147 6.0E-09
sp|Q891G4|CH60_CLOTE 60 kDa chaperonin OS=Clostridium tetani (strain Massachusetts / E88) GN=groL PE=3 SV=1 11 231 7.0E-09
sp|A0Q2T1|CH60_CLONN 60 kDa chaperonin OS=Clostridium novyi (strain NT) GN=groL PE=3 SV=1 17 231 8.0E-09
sp|A4J8H4|CH60_DESRM 60 kDa chaperonin OS=Desulfotomaculum reducens (strain MI-1) GN=groL PE=3 SV=1 12 155 8.0E-09
sp|A4QHB7|CH602_CORGB 60 kDa chaperonin 2 OS=Corynebacterium glutamicum (strain R) GN=groL2 PE=3 SV=1 12 146 8.0E-09
sp|Q7NT31|CH601_CHRVO 60 kDa chaperonin 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=groL1 PE=3 SV=1 30 140 9.0E-09
sp|P21241|RUBB_BRANA RuBisCO large subunit-binding protein subunit beta, chloroplastic OS=Brassica napus PE=2 SV=1 24 234 9.0E-09
sp|Q8NM64|CH602_CORGL 60 kDa chaperonin 2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=groL2 PE=3 SV=1 12 146 9.0E-09
sp|B1YEP6|CH60_EXIS2 60 kDa chaperonin OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=groL PE=3 SV=1 30 231 9.0E-09
sp|Q8CY22|CH602_COREF 60 kDa chaperonin 2 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=groL2 PE=3 SV=1 12 146 9.0E-09
sp|Q47IZ8|CH60_DECAR 60 kDa chaperonin OS=Dechloromonas aromatica (strain RCB) GN=groL PE=3 SV=1 30 147 1.0E-08
sp|A7Z207|CH60_BACMF 60 kDa chaperonin OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=groL PE=3 SV=1 30 231 1.0E-08
sp|A9B6A4|CH60_HERA2 60 kDa chaperonin OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=groL PE=3 SV=1 12 524 1.0E-08
sp|P37282|CH60_LACLA 60 kDa chaperonin OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=groL PE=3 SV=2 30 231 1.0E-08
sp|P28598|CH60_BACSU 60 kDa chaperonin OS=Bacillus subtilis (strain 168) GN=groL PE=1 SV=3 30 231 1.0E-08
sp|A4IJV3|CH60_GEOTN 60 kDa chaperonin OS=Geobacillus thermodenitrificans (strain NG80-2) GN=groL PE=3 SV=1 30 231 1.0E-08
sp|B7GFR6|CH60_ANOFW 60 kDa chaperonin OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=groL PE=3 SV=1 30 231 1.0E-08
sp|Q60024|CH60_THEBR 60 kDa chaperonin OS=Thermoanaerobacter brockii GN=groL PE=1 SV=2 12 157 1.0E-08
sp|Q9AEP7|CH60_LACLM 60 kDa chaperonin OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=groL PE=3 SV=1 30 231 1.0E-08
sp|Q031S8|CH60_LACLS 60 kDa chaperonin OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=groL PE=3 SV=1 30 231 1.0E-08
sp|P59526|CH60_BUCBP 60 kDa chaperonin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=groL PE=3 SV=1 30 231 1.0E-08
sp|Q9LJE4|CPNB2_ARATH Chaperonin 60 subunit beta 2, chloroplastic OS=Arabidopsis thaliana GN=CPN60B2 PE=1 SV=1 30 196 1.0E-08
sp|Q5L3E6|CH60_GEOKA 60 kDa chaperonin OS=Geobacillus kaustophilus (strain HTA426) GN=groL PE=3 SV=1 30 231 1.0E-08
sp|C5D4F4|CH60_GEOSW 60 kDa chaperonin OS=Geobacillus sp. (strain WCH70) GN=groL PE=3 SV=1 30 231 1.0E-08
sp|C4L1L2|CH60_EXISA 60 kDa chaperonin OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=groL PE=3 SV=1 30 231 1.0E-08
sp|Q1RIZ3|CH60_RICBR 60 kDa chaperonin OS=Rickettsia bellii (strain RML369-C) GN=groL PE=3 SV=1 30 231 2.0E-08
sp|A8GW07|CH60_RICB8 60 kDa chaperonin OS=Rickettsia bellii (strain OSU 85-389) GN=groL PE=3 SV=1 30 231 2.0E-08
sp|A6U7N0|CH602_SINMW 60 kDa chaperonin 2 OS=Sinorhizobium medicae (strain WSM419) GN=groL2 PE=3 SV=1 30 231 2.0E-08
sp|Q8KTS0|CH60_TREPR 60 kDa chaperonin OS=Tremblaya princeps GN=groL PE=3 SV=1 17 147 2.0E-08
sp|Q8KIX4|CH60_BUCPP 60 kDa chaperonin OS=Buchnera aphidicola subsp. Pterocomma populeum GN=groL PE=3 SV=1 30 231 2.0E-08
sp|A0LKS4|CH602_SYNFM 60 kDa chaperonin 2 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=groL2 PE=3 SV=1 24 231 2.0E-08
sp|B1ZAU5|CH60_METPB 60 kDa chaperonin OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=groL PE=3 SV=1 30 132 2.0E-08
sp|B1I661|CH60_DESAP 60 kDa chaperonin OS=Desulforudis audaxviator (strain MP104C) GN=groL PE=3 SV=1 19 231 2.0E-08
sp|Q162U5|CH602_ROSDO 60 kDa chaperonin 2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=groL2 PE=3 SV=1 30 231 2.0E-08
sp|Q8KJ20|CH60_STRAP 60 kDa chaperonin OS=Streptococcus anginosus GN=groL PE=3 SV=1 30 231 2.0E-08
sp|P31294|CH60_HAEDU 60 kDa chaperonin OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=groL PE=3 SV=2 30 147 2.0E-08
sp|Q8KJ18|CH60_STRCV 60 kDa chaperonin OS=Streptococcus constellatus GN=groL PE=3 SV=1 30 231 2.0E-08
sp|Q93QI2|CH60_RHOHA 60 kDa chaperonin OS=Rhodococcus hoagii GN=groL PE=3 SV=1 12 138 2.0E-08
sp|Q9AFA6|CH602_NOCFA 60 kDa chaperonin 2 OS=Nocardia farcinica (strain IFM 10152) GN=groL2 PE=3 SV=2 12 138 2.0E-08
sp|A1K436|CH601_AZOSB 60 kDa chaperonin 1 OS=Azoarcus sp. (strain BH72) GN=groL1 PE=3 SV=1 11 147 3.0E-08
sp|A8YTH8|CH60_LACH4 60 kDa chaperonin OS=Lactobacillus helveticus (strain DPC 4571) GN=groL PE=3 SV=1 30 231 3.0E-08
sp|Q13IM9|CH605_BURXL 60 kDa chaperonin 5 OS=Burkholderia xenovorans (strain LB400) GN=groL5 PE=3 SV=1 30 147 3.0E-08
sp|P30779|CH60_AGRFC 60 kDa chaperonin OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=groL PE=3 SV=2 30 231 3.0E-08
sp|B3PLM6|CH60_CELJU 60 kDa chaperonin OS=Cellvibrio japonicus (strain Ueda107) GN=groL PE=3 SV=1 11 140 3.0E-08
sp|A5F4Y1|CH602_VIBC3 60 kDa chaperonin 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=groL2 PE=3 SV=1 11 140 3.0E-08
sp|A9GBQ2|CH602_SORC5 60 kDa chaperonin 2 OS=Sorangium cellulosum (strain So ce56) GN=groL2 PE=3 SV=1 18 231 3.0E-08
sp|P30717|CH60_CLOAB 60 kDa chaperonin OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=groL PE=3 SV=1 17 157 3.0E-08
sp|Q8CX00|CH60_STRA5 60 kDa chaperonin OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=groL PE=3 SV=1 30 231 3.0E-08
sp|Q3JYQ0|CH60_STRA1 60 kDa chaperonin OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=groL PE=3 SV=1 30 231 3.0E-08
sp|Q9KNR7|CH601_VIBCH 60 kDa chaperonin 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=groL1 PE=3 SV=1 11 140 3.0E-08
sp|Q95058|CH60_TRIVA Hydrogenosomal chaperonin HSP60 OS=Trichomonas vaginalis GN=HSP60 PE=3 SV=1 30 237 3.0E-08
sp|Q13NE4|CH604_BURXL 60 kDa chaperonin 4 OS=Burkholderia xenovorans (strain LB400) GN=groL4 PE=3 SV=1 30 147 3.0E-08
sp|Q8CX22|CH60_STRA3 60 kDa chaperonin OS=Streptococcus agalactiae serotype III (strain NEM316) GN=groL PE=3 SV=1 30 231 3.0E-08
sp|A6TLJ1|CH60_ALKMQ 60 kDa chaperonin OS=Alkaliphilus metalliredigens (strain QYMF) GN=groL PE=3 SV=1 11 123 3.0E-08
sp|A6U6I5|CH601_SINMW 60 kDa chaperonin 1 OS=Sinorhizobium medicae (strain WSM419) GN=groL1 PE=3 SV=1 30 231 3.0E-08
sp|Q38YR7|CH60_LACSS 60 kDa chaperonin OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=groL PE=3 SV=1 30 231 3.0E-08
sp|B5FFY0|CH60_VIBFM 60 kDa chaperonin OS=Vibrio fischeri (strain MJ11) GN=groL PE=3 SV=1 30 140 3.0E-08
sp|Q5E8E6|CH60_VIBF1 60 kDa chaperonin OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=groL PE=3 SV=1 30 140 3.0E-08
sp|Q1MKX4|CH601_RHIL3 60 kDa chaperonin 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=groL1 PE=3 SV=1 30 231 3.0E-08
sp|P34939|CH60_RHILV 60 kDa chaperonin OS=Rhizobium leguminosarum bv. viciae GN=groL PE=2 SV=1 30 231 3.0E-08
sp|Q93GT6|CH60_TETHA 60 kDa chaperonin OS=Tetragenococcus halophilus GN=groL PE=3 SV=2 30 231 3.0E-08
sp|B5ZRD6|CH60_RHILW 60 kDa chaperonin OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=groL PE=3 SV=1 30 231 3.0E-08
sp|Q983S4|CH604_RHILO 60 kDa chaperonin 4 OS=Rhizobium loti (strain MAFF303099) GN=groL4 PE=3 SV=1 30 231 4.0E-08
sp|A6UM48|CH605_SINMW 60 kDa chaperonin 5 OS=Sinorhizobium medicae (strain WSM419) GN=groL5 PE=3 SV=1 30 231 4.0E-08
sp|Q5SLM2|CH60_THET8 60 kDa chaperonin OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=groL PE=1 SV=3 12 233 4.0E-08
sp|P61490|CH60_THET2 60 kDa chaperonin OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=groL PE=1 SV=2 12 233 4.0E-08
sp|Q3SPG4|CH603_NITWN 60 kDa chaperonin 3 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=groL3 PE=3 SV=1 30 231 4.0E-08
sp|A1W3W8|CH60_ACISJ 60 kDa chaperonin OS=Acidovorax sp. (strain JS42) GN=groL PE=3 SV=1 30 132 4.0E-08
sp|Q2KBZ7|CH601_RHIEC 60 kDa chaperonin 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=groL1 PE=3 SV=1 30 231 4.0E-08
sp|Q981J9|CH605_RHILO 60 kDa chaperonin 5 OS=Rhizobium loti (strain MAFF303099) GN=groL5 PE=3 SV=1 30 231 4.0E-08
sp|Q47LP1|CH602_THEFY 60 kDa chaperonin 2 OS=Thermobifida fusca (strain YX) GN=groL2 PE=3 SV=1 12 524 4.0E-08
sp|B9MDC5|CH60_ACIET 60 kDa chaperonin OS=Acidovorax ebreus (strain TPSY) GN=groL PE=3 SV=1 30 132 4.0E-08
sp|Q8Y1P8|CH60_RALSO 60 kDa chaperonin OS=Ralstonia solanacearum (strain GMI1000) GN=groL PE=3 SV=1 17 147 5.0E-08
sp|A0LR17|CH601_ACIC1 60 kDa chaperonin 1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=groL1 PE=3 SV=1 12 234 5.0E-08
sp|P0CY96|CH60_PROAA 60 kDa chaperonin OS=Propionibacterium acnes GN=groL PE=3 SV=1 4 234 5.0E-08
sp|P0CY97|CH601_PROAC 60 kDa chaperonin 1 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=groL1 PE=3 SV=1 4 234 5.0E-08
sp|O68324|CH60_LACHE 60 kDa chaperonin OS=Lactobacillus helveticus GN=groL PE=3 SV=1 30 231 5.0E-08
sp|A6UNR2|CH60_METVS 60 kDa chaperonin OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=groL PE=3 SV=1 30 136 5.0E-08
sp|Q92ZQ4|CH604_RHIME 60 kDa chaperonin 4 OS=Rhizobium meliloti (strain 1021) GN=groL4 PE=3 SV=1 30 134 5.0E-08
sp|Q6MRI1|CH60_BDEBA 60 kDa chaperonin OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=groL PE=3 SV=1 30 540 5.0E-08
sp|Q93G07|CH60_LACAC 60 kDa chaperonin OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=groL PE=3 SV=2 30 159 5.0E-08
sp|Q6LM06|CH60_PHOPR 60 kDa chaperonin OS=Photobacterium profundum GN=groL PE=3 SV=1 30 142 5.0E-08
sp|B4SKL8|CH60_STRM5 60 kDa chaperonin OS=Stenotrophomonas maltophilia (strain R551-3) GN=groL PE=3 SV=1 11 147 5.0E-08
sp|A7NIK8|CH601_ROSCS 60 kDa chaperonin 1 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=groL1 PE=3 SV=1 12 231 5.0E-08
sp|Q2T3W7|CH602_BURTA 60 kDa chaperonin 2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=groL2 PE=3 SV=1 30 147 6.0E-08
sp|Q929V0|CH60_LISIN 60 kDa chaperonin OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=groL PE=3 SV=1 30 231 6.0E-08
sp|Q67KB8|CH60_SYMTH 60 kDa chaperonin OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=groL PE=3 SV=1 1 147 6.0E-08
sp|Q9AGE6|CH60_LISMO 60 kDa chaperonin OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=groL PE=3 SV=1 30 231 6.0E-08
sp|B8DH59|CH60_LISMH 60 kDa chaperonin OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=groL PE=3 SV=1 30 231 6.0E-08
sp|Q71XU6|CH60_LISMF 60 kDa chaperonin OS=Listeria monocytogenes serotype 4b (strain F2365) GN=groL PE=3 SV=1 30 231 6.0E-08
sp|C1KX21|CH60_LISMC 60 kDa chaperonin OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=groL PE=3 SV=1 30 231 6.0E-08
sp|P35470|CH602_RHIME 60 kDa chaperonin 2 OS=Rhizobium meliloti (strain 1021) GN=groL2 PE=2 SV=2 30 231 6.0E-08
sp|A8AZE1|CH60_STRGC 60 kDa chaperonin OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=groL PE=3 SV=1 30 231 6.0E-08
sp|P26821|CH60_CLOPE 60 kDa chaperonin OS=Clostridium perfringens (strain 13 / Type A) GN=groL PE=3 SV=2 17 140 6.0E-08
sp|A0AKH5|CH60_LISW6 60 kDa chaperonin OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=groL PE=3 SV=1 30 231 6.0E-08
sp|A3N120|CH60_ACTP2 60 kDa chaperonin OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=groL PE=3 SV=1 30 147 6.0E-08
sp|Q0TN27|CH60_CLOP1 60 kDa chaperonin OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=groL PE=3 SV=1 17 140 6.0E-08
sp|Q8VT58|CH60_STRGN 60 kDa chaperonin OS=Streptococcus gordonii GN=groL PE=3 SV=1 30 231 6.0E-08
sp|Q07TB7|CH601_RHOP5 60 kDa chaperonin 1 OS=Rhodopseudomonas palustris (strain BisA53) GN=groL1 PE=3 SV=1 30 140 6.0E-08
sp|B0K3P6|CH60_THEPX 60 kDa chaperonin OS=Thermoanaerobacter sp. (strain X514) GN=groL PE=3 SV=1 12 157 6.0E-08
sp|B0KBR3|CH60_THEP3 60 kDa chaperonin OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=groL PE=3 SV=1 12 157 6.0E-08
sp|B0BPV1|CH60_ACTPJ 60 kDa chaperonin OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=groL PE=3 SV=1 30 147 6.0E-08
sp|B3H1P4|CH60_ACTP7 60 kDa chaperonin OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=groL PE=3 SV=1 30 147 6.0E-08
sp|P94166|CH60_ACTPL 60 kDa chaperonin OS=Actinobacillus pleuropneumoniae GN=groL PE=3 SV=3 30 147 6.0E-08
sp|B1HT15|CH60_LYSSC 60 kDa chaperonin OS=Lysinibacillus sphaericus (strain C3-41) GN=groL PE=3 SV=1 30 231 7.0E-08
sp|Q0SET3|CH601_RHOJR 60 kDa chaperonin 1 OS=Rhodococcus jostii (strain RHA1) GN=groL1 PE=3 SV=1 12 144 7.0E-08
sp|A0PNL7|CH602_MYCUA 60 kDa chaperonin 2 OS=Mycobacterium ulcerans (strain Agy99) GN=groL2 PE=3 SV=1 12 144 7.0E-08
sp|A6H125|CH60_FLAPJ 60 kDa chaperonin OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=groL PE=3 SV=1 30 231 7.0E-08
sp|O33658|CH602_STRLI 60 kDa chaperonin 2 OS=Streptomyces lividans GN=groL2 PE=3 SV=3 12 131 7.0E-08
sp|P35469|CH601_RHIME 60 kDa chaperonin 1 OS=Rhizobium meliloti (strain 1021) GN=groL1 PE=2 SV=2 30 134 8.0E-08
sp|C0MES3|CH60_STRS7 60 kDa chaperonin OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=groL PE=3 SV=1 30 231 8.0E-08
sp|O34198|CH60_RICRI 60 kDa chaperonin (Fragment) OS=Rickettsia rickettsii GN=groL PE=3 SV=1 30 231 8.0E-08
sp|A1SNU4|CH602_NOCSJ 60 kDa chaperonin 2 OS=Nocardioides sp. (strain BAA-499 / JS614) GN=groL2 PE=3 SV=1 12 234 8.0E-08
sp|O66192|CH60_KLUIN 60 kDa chaperonin (Fragment) OS=Kluyvera intermedia GN=groL PE=3 SV=1 30 140 8.0E-08
sp|Q05FT9|CH60_CARRP 60 kDa chaperonin OS=Carsonella ruddii (strain PV) GN=groL PE=3 SV=1 15 231 9.0E-08
sp|Q9AFC5|CH60_NOCAS 60 kDa chaperonin OS=Nocardia asteroides GN=groL PE=3 SV=1 12 138 9.0E-08
sp|Q9ZFE0|CH60_BURCE 60 kDa chaperonin OS=Burkholderia cepacia GN=groL PE=3 SV=1 30 147 9.0E-08
sp|A5V0S2|CH602_ROSS1 60 kDa chaperonin 2 OS=Roseiflexus sp. (strain RS-1) GN=groL2 PE=3 SV=1 30 231 9.0E-08
sp|A0K536|CH601_BURCH 60 kDa chaperonin 1 OS=Burkholderia cenocepacia (strain HI2424) GN=groL1 PE=3 SV=1 30 147 9.0E-08
sp|Q1BYL5|CH601_BURCA 60 kDa chaperonin 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=groL1 PE=3 SV=1 30 147 9.0E-08
sp|A6VM38|CH60_ACTSZ 60 kDa chaperonin OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=groL PE=3 SV=1 11 147 9.0E-08
sp|Q9ZFD8|CH60_BURVI 60 kDa chaperonin OS=Burkholderia vietnamiensis GN=groL PE=3 SV=1 30 147 9.0E-08
sp|A4JC03|CH601_BURVG 60 kDa chaperonin 1 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=groL1 PE=3 SV=1 30 147 9.0E-08
sp|Q0BHT1|CH601_BURCM 60 kDa chaperonin 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=groL1 PE=3 SV=1 30 147 9.0E-08
sp|O66210|CH60_KLEOX 60 kDa chaperonin (Fragment) OS=Klebsiella oxytoca GN=groL PE=3 SV=1 30 140 9.0E-08
sp|B8ER20|CH60_METSB 60 kDa chaperonin OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=groL PE=3 SV=1 30 126 1.0E-07
sp|O66214|CH60_RAOOR 60 kDa chaperonin (Fragment) OS=Raoultella ornithinolytica GN=groL PE=3 SV=1 30 140 1.0E-07
sp|Q1GJ36|CH60_RUEST 60 kDa chaperonin OS=Ruegeria sp. (strain TM1040) GN=groL PE=3 SV=1 30 231 1.0E-07
sp|P58723|CH60_BURTH 60 kDa chaperonin OS=Burkholderia thailandensis GN=groL PE=3 SV=1 30 147 1.0E-07
sp|Q2SYJ5|CH601_BURTA 60 kDa chaperonin 1 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=groL1 PE=3 SV=1 30 147 1.0E-07
sp|Q3JPF6|CH601_BURP1 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain 1710b) GN=groL1 PE=3 SV=1 30 147 1.0E-07
sp|A3NYH0|CH601_BURP0 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain 1106a) GN=groL1 PE=3 SV=1 30 147 1.0E-07
sp|A1V1Z9|CH60_BURMS 60 kDa chaperonin OS=Burkholderia mallei (strain SAVP1) GN=groL PE=3 SV=1 30 147 1.0E-07
sp|Q62I82|CH60_BURMA 60 kDa chaperonin OS=Burkholderia mallei (strain ATCC 23344) GN=groL PE=3 SV=1 30 147 1.0E-07
sp|A2S9S5|CH60_BURM9 60 kDa chaperonin OS=Burkholderia mallei (strain NCTC 10229) GN=groL PE=3 SV=1 30 147 1.0E-07
sp|A3MMB4|CH60_BURM7 60 kDa chaperonin OS=Burkholderia mallei (strain NCTC 10247) GN=groL PE=3 SV=1 30 147 1.0E-07
sp|P95647|CH602_RHOSH 60 kDa chaperonin 2 OS=Rhodobacter sphaeroides GN=groL2 PE=3 SV=1 16 231 1.0E-07
sp|Q9F712|CH601_BURPS 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain K96243) GN=groL1 PE=3 SV=2 30 147 1.0E-07
sp|A3NCQ8|CH601_BURP6 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain 668) GN=groL1 PE=3 SV=1 30 147 1.0E-07
sp|A3P2X2|CH602_BURP0 60 kDa chaperonin 2 OS=Burkholderia pseudomallei (strain 1106a) GN=groL2 PE=3 SV=1 30 147 1.0E-07
sp|P0DA23|CH60_STRPQ 60 kDa chaperonin OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=groL PE=3 SV=1 30 231 1.0E-07
sp|P0DA22|CH60_STRP3 60 kDa chaperonin OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=groL PE=3 SV=1 30 231 1.0E-07
sp|A7MMC0|CH60_CROS8 60 kDa chaperonin OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=groL PE=3 SV=1 30 140 1.0E-07
sp|A3NHB6|CH602_BURP6 60 kDa chaperonin 2 OS=Burkholderia pseudomallei (strain 668) GN=groL2 PE=3 SV=1 30 147 1.0E-07
sp|Q8NZ56|CH60_STRP8 60 kDa chaperonin OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=groL PE=3 SV=3 30 231 1.0E-07
sp|Q39J12|CH602_BURL3 60 kDa chaperonin 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=groL2 PE=3 SV=1 30 147 1.0E-07
sp|Q1JEL5|CH60_STRPD 60 kDa chaperonin OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=groL PE=3 SV=1 30 231 1.0E-07
sp|B2T0I0|CH60_BURPP 60 kDa chaperonin OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=groL PE=3 SV=1 17 147 1.0E-07
sp|B4U081|CH60_STREM 60 kDa chaperonin OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=groL PE=3 SV=1 30 231 1.0E-07
sp|P0A338|CH602_THEVL 60 kDa chaperonin 2 OS=Thermosynechococcus vulcanus GN=groL2 PE=3 SV=1 4 231 1.0E-07
sp|P0A337|CH602_THEEB 60 kDa chaperonin 2 OS=Thermosynechococcus elongatus (strain BP-1) GN=groL2 PE=3 SV=1 4 231 1.0E-07
sp|Q48R03|CH60_STRPM 60 kDa chaperonin OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=groL PE=3 SV=1 30 231 1.0E-07
sp|Q1J4D1|CH60_STRPF 60 kDa chaperonin OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=groL PE=3 SV=1 30 231 1.0E-07
sp|Q1JJL5|CH60_STRPC 60 kDa chaperonin OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=groL PE=3 SV=1 30 231 1.0E-07
sp|Q1J9G4|CH60_STRPB 60 kDa chaperonin OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=groL PE=3 SV=1 30 231 1.0E-07
sp|Q63N20|CH602_BURPS 60 kDa chaperonin 2 OS=Burkholderia pseudomallei (strain K96243) GN=groL2 PE=3 SV=1 30 147 1.0E-07
sp|Q3JGX2|CH602_BURP1 60 kDa chaperonin 2 OS=Burkholderia pseudomallei (strain 1710b) GN=groL2 PE=3 SV=1 30 147 1.0E-07
sp|C0M7S3|CH60_STRE4 60 kDa chaperonin OS=Streptococcus equi subsp. equi (strain 4047) GN=groL PE=3 SV=1 30 231 1.0E-07
sp|B8F865|CH60_HAEPS 60 kDa chaperonin OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=groL PE=3 SV=1 30 147 1.0E-07
sp|Q9KXU5|CH602_STRCO 60 kDa chaperonin 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=groL2 PE=3 SV=1 12 131 1.0E-07
sp|B5XIW7|CH60_STRPZ 60 kDa chaperonin OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=groL PE=3 SV=1 30 231 1.0E-07
sp|A2RGR1|CH60_STRPG 60 kDa chaperonin OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=groL PE=3 SV=1 30 231 1.0E-07
sp|Q5X9L8|CH60_STRP6 60 kDa chaperonin OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=groL PE=1 SV=3 30 231 1.0E-07
sp|P69883|CH60_STRP1 60 kDa chaperonin OS=Streptococcus pyogenes serotype M1 GN=groL PE=3 SV=2 30 231 1.0E-07
sp|B2JFE0|CH60_BURP8 60 kDa chaperonin OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=groL PE=3 SV=1 30 147 1.0E-07
sp|O66198|CH60_ENTAK 60 kDa chaperonin OS=Enterobacter aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006) GN=groL PE=3 SV=2 30 140 1.0E-07
sp|Q59687|CH60_PASMU 60 kDa chaperonin OS=Pasteurella multocida (strain Pm70) GN=groL PE=3 SV=2 11 147 1.0E-07
sp|A0AXY5|CH602_BURCH 60 kDa chaperonin 2 OS=Burkholderia cenocepacia (strain HI2424) GN=groL2 PE=3 SV=1 30 147 1.0E-07
sp|C3KUC8|CH60_CLOB6 60 kDa chaperonin OS=Clostridium botulinum (strain 657 / Type Ba4) GN=groL PE=3 SV=1 11 198 1.0E-07
sp|A7GIN3|CH60_CLOBL 60 kDa chaperonin OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=groL PE=3 SV=1 11 198 1.0E-07
sp|B1IFD4|CH60_CLOBK 60 kDa chaperonin OS=Clostridium botulinum (strain Okra / Type B1) GN=groL PE=3 SV=1 11 198 1.0E-07
sp|C1FLV5|CH60_CLOBJ 60 kDa chaperonin OS=Clostridium botulinum (strain Kyoto / Type A2) GN=groL PE=3 SV=1 11 198 1.0E-07
sp|A5I723|CH60_CLOBH 60 kDa chaperonin OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=groL PE=3 SV=1 11 198 1.0E-07
sp|A7FYP3|CH60_CLOB1 60 kDa chaperonin OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=groL PE=3 SV=1 11 198 1.0E-07
sp|B1L1K0|CH60_CLOBM 60 kDa chaperonin OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=groL PE=3 SV=1 11 198 1.0E-07
sp|Q1BEF6|CH601_MYCSS 60 kDa chaperonin 1 OS=Mycobacterium sp. (strain MCS) GN=groL1 PE=3 SV=2 12 144 1.0E-07
sp|A1UAH8|CH601_MYCSK 60 kDa chaperonin 1 OS=Mycobacterium sp. (strain KMS) GN=groL1 PE=3 SV=1 12 144 1.0E-07
sp|A3PU33|CH601_MYCSJ 60 kDa chaperonin 1 OS=Mycobacterium sp. (strain JLS) GN=groL1 PE=3 SV=1 12 144 1.0E-07
sp|A8GPB6|CH60_RICAH 60 kDa chaperonin OS=Rickettsia akari (strain Hartford) GN=groL PE=3 SV=1 30 231 1.0E-07
sp|A5CZ03|CH60_PELTS 60 kDa chaperonin OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=groL PE=3 SV=1 12 231 1.0E-07
sp|A1T352|CH601_MYCVP 60 kDa chaperonin 1 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=groL1 PE=3 SV=1 12 144 1.0E-07
sp|A0JT07|CH601_ARTS2 60 kDa chaperonin 1 OS=Arthrobacter sp. (strain FB24) GN=groL1 PE=3 SV=1 12 234 1.0E-07
sp|Q5P7G2|CH60_AROAE 60 kDa chaperonin OS=Aromatoleum aromaticum (strain EbN1) GN=groL PE=3 SV=1 11 147 1.0E-07
sp|Q144Q6|CH601_BURXL 60 kDa chaperonin 1 OS=Burkholderia xenovorans (strain LB400) GN=groL1 PE=3 SV=1 17 147 1.0E-07
sp|Q9KJ23|CH60_LACJO 60 kDa chaperonin OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=groL PE=3 SV=2 30 231 1.0E-07
sp|Q65VE4|CH60_MANSM 60 kDa chaperonin OS=Mannheimia succiniciproducens (strain MBEL55E) GN=groL PE=3 SV=1 11 147 1.0E-07
sp|P42384|CH602_MYCPA 60 kDa chaperonin 2 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=groL2 PE=3 SV=4 12 144 1.0E-07
sp|A0QLP6|CH602_MYCA1 60 kDa chaperonin 2 OS=Mycobacterium avium (strain 104) GN=groL2 PE=3 SV=1 12 144 1.0E-07
sp|C3PP72|CH60_RICAE 60 kDa chaperonin OS=Rickettsia africae (strain ESF-5) GN=groL PE=3 SV=1 30 231 1.0E-07
sp|P40171|CH601_STRCO 60 kDa chaperonin 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=groL1 PE=3 SV=3 4 126 1.0E-07
sp|O66204|CH60_SERFI 60 kDa chaperonin (Fragment) OS=Serratia ficaria GN=groL PE=3 SV=1 30 140 1.0E-07
sp|Q92H04|CH60_RICCN 60 kDa chaperonin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=groL PE=3 SV=1 30 231 1.0E-07
sp|O66206|CH60_SERMA 60 kDa chaperonin (Fragment) OS=Serratia marcescens GN=groL PE=3 SV=1 30 140 1.0E-07
sp|C6DKC7|CH60_PECCP 60 kDa chaperonin OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=groL PE=3 SV=1 30 140 1.0E-07
sp|Q82DI5|CH601_STRAW 60 kDa chaperonin 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=groL1 PE=3 SV=3 4 126 1.0E-07
sp|A8GT30|CH60_RICRS 60 kDa chaperonin OS=Rickettsia rickettsii (strain Sheila Smith) GN=groL PE=3 SV=1 30 231 1.0E-07
sp|B0BUM0|CH60_RICRO 60 kDa chaperonin OS=Rickettsia rickettsii (strain Iowa) GN=groL PE=3 SV=1 30 231 1.0E-07
sp|C4K2T9|CH60_RICPU 60 kDa chaperonin OS=Rickettsia peacockii (strain Rustic) GN=groL PE=3 SV=1 30 231 1.0E-07
sp|Q20X88|CH602_RHOPB 60 kDa chaperonin 2 OS=Rhodopseudomonas palustris (strain BisB18) GN=groL2 PE=3 SV=1 30 134 2.0E-07
sp|O66196|CH60_LELAM 60 kDa chaperonin (Fragment) OS=Lelliottia amnigena GN=groL PE=3 SV=1 30 140 2.0E-07
sp|Q4UMF2|CH60_RICFE 60 kDa chaperonin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=groL PE=3 SV=1 30 231 2.0E-07
sp|Q2KAU2|CH602_RHIEC 60 kDa chaperonin 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=groL2 PE=3 SV=1 30 231 2.0E-07
sp|A4W5N8|CH60_ENT38 60 kDa chaperonin OS=Enterobacter sp. (strain 638) GN=groL PE=3 SV=1 30 140 2.0E-07
sp|P9WPE7|CH602_MYCTU 60 kDa chaperonin 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=groEL2 PE=1 SV=1 12 126 2.0E-07
sp|P9WPE6|CH602_MYCTO 60 kDa chaperonin 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=groEL2 PE=3 SV=1 12 126 2.0E-07
sp|P0A521|CH602_MYCBO 60 kDa chaperonin 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=groL2 PE=1 SV=2 12 126 2.0E-07
sp|A5TZG6|CH601_MYCTA 60 kDa chaperonin 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=groL1 PE=3 SV=1 12 126 2.0E-07
sp|A1KFR2|CH601_MYCBP 60 kDa chaperonin 1 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=groL1 PE=3 SV=1 12 126 2.0E-07
sp|Q93EU6|CH60_ENTFA 60 kDa chaperonin OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=groL PE=3 SV=2 30 231 2.0E-07
sp|O66220|CH60_PECCC 60 kDa chaperonin (Fragment) OS=Pectobacterium carotovorum subsp. carotovorum GN=groL PE=3 SV=1 30 140 2.0E-07
sp|A0LRS7|CH602_ACIC1 60 kDa chaperonin 2 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=groL2 PE=3 SV=1 30 231 2.0E-07
sp|A9WN14|CH602_RENSM 60 kDa chaperonin 2 OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=groL2 PE=3 SV=1 18 131 2.0E-07
sp|A8LJP9|CH60_DINSH 60 kDa chaperonin OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=groL PE=3 SV=1 30 231 2.0E-07
sp|A4X1K4|CH601_SALTO 60 kDa chaperonin 1 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=groL1 PE=3 SV=1 12 155 2.0E-07
sp|Q4JXN8|CH601_CORJK 60 kDa chaperonin 1 OS=Corynebacterium jeikeium (strain K411) GN=groL1 PE=3 SV=1 12 124 2.0E-07
sp|Q1QVJ7|CH60_CHRSD 60 kDa chaperonin OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=groL PE=3 SV=1 3 140 2.0E-07
sp|Q9AFA5|CH60_TSUPA 60 kDa chaperonin OS=Tsukamurella paurometabola GN=groL PE=3 SV=1 12 131 2.0E-07
sp|Q7MBB2|CH60_MYCGA 60 kDa chaperonin OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=groL PE=3 SV=2 30 145 2.0E-07
sp|P48219|CH60_YEREN 60 kDa chaperonin OS=Yersinia enterocolitica GN=groL PE=3 SV=1 30 140 2.0E-07
sp|A1JIP3|CH60_YERE8 60 kDa chaperonin OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=groL PE=3 SV=1 30 140 2.0E-07
sp|P60364|CH601_RHOPA 60 kDa chaperonin 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=groL1 PE=3 SV=1 30 231 2.0E-07
sp|Q8CWW6|CH60_STRMU 60 kDa chaperonin OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=groL PE=3 SV=1 30 231 2.0E-07
sp|A8F2B5|CH60_RICM5 60 kDa chaperonin OS=Rickettsia massiliae (strain Mtu5) GN=groL PE=3 SV=2 30 231 2.0E-07
sp|B5Y368|CH60_KLEP3 60 kDa chaperonin OS=Klebsiella pneumoniae (strain 342) GN=groL PE=3 SV=1 30 140 2.0E-07
sp|P48220|CH60_ZYMMO 60 kDa chaperonin OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=groL PE=3 SV=2 30 140 2.0E-07
sp|Q1C0Y0|CH60_YERPA 60 kDa chaperonin OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=groL PE=3 SV=1 30 140 2.0E-07
sp|Q1AXU6|CH60_RUBXD 60 kDa chaperonin OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=groL PE=3 SV=1 18 132 2.0E-07
sp|B1JMR1|CH60_YERPY 60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=groL PE=3 SV=1 30 140 2.0E-07
sp|Q66FD5|CH60_YERPS 60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=groL PE=3 SV=1 30 140 2.0E-07
sp|A4TRR0|CH60_YERPP 60 kDa chaperonin OS=Yersinia pestis (strain Pestoides F) GN=groL PE=3 SV=1 30 140 2.0E-07
sp|Q1CED4|CH60_YERPN 60 kDa chaperonin OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=groL PE=3 SV=1 30 140 2.0E-07
sp|A9QYQ1|CH60_YERPG 60 kDa chaperonin OS=Yersinia pestis bv. Antiqua (strain Angola) GN=groL PE=3 SV=1 30 140 2.0E-07
sp|Q8ZIY3|CH60_YERPE 60 kDa chaperonin OS=Yersinia pestis GN=groL PE=3 SV=1 30 140 2.0E-07
sp|B2K1Y4|CH60_YERPB 60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=groL PE=3 SV=1 30 140 2.0E-07
sp|A7FN01|CH60_YERP3 60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=groL PE=3 SV=1 30 140 2.0E-07
sp|A8LYN0|CH601_SALAI 60 kDa chaperonin 1 OS=Salinispora arenicola (strain CNS-205) GN=groL1 PE=3 SV=1 12 155 2.0E-07
sp|B9L698|CH60_NAUPA 60 kDa chaperonin OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=groL PE=3 SV=1 30 231 2.0E-07
sp|Q7TTY9|CH603_RHOBA 60 kDa chaperonin 3 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=groL3 PE=3 SV=1 30 233 2.0E-07
sp|Q46XW6|CH60_CUPPJ 60 kDa chaperonin OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=groL PE=3 SV=1 17 147 2.0E-07
sp|P09239|CH602_MYCLE 60 kDa chaperonin 2 OS=Mycobacterium leprae (strain TN) GN=groL2 PE=3 SV=3 12 126 2.0E-07
sp|A8G8S7|CH60_SERP5 60 kDa chaperonin OS=Serratia proteamaculans (strain 568) GN=groL PE=3 SV=1 30 140 2.0E-07
sp|Q8KIX2|CH60_BUCTS 60 kDa chaperonin OS=Buchnera aphidicola subsp. Thelaxes suberi GN=groL PE=3 SV=1 30 140 2.0E-07
sp|B9DW28|CH60_STRU0 60 kDa chaperonin OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=groL PE=3 SV=1 30 231 2.0E-07
sp|Q19NJ4|CH602_ECOK1 60 kDa chaperonin 2 OS=Escherichia coli O1:K1 / APEC GN=groL2 PE=3 SV=1 15 147 2.0E-07
sp|Q0KDR7|CH60_CUPNH 60 kDa chaperonin OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=groL PE=3 SV=1 17 147 2.0E-07
sp|Q130Z3|CH602_RHOPS 60 kDa chaperonin 2 OS=Rhodopseudomonas palustris (strain BisB5) GN=groL2 PE=3 SV=1 30 231 2.0E-07
sp|O66218|CH60_PANAN 60 kDa chaperonin (Fragment) OS=Pantoea ananas GN=groL PE=3 SV=1 30 140 2.0E-07
sp|Q0RBS5|CH603_FRAAA 60 kDa chaperonin 3 OS=Frankia alni (strain ACN14a) GN=groL3 PE=3 SV=2 12 126 2.0E-07
sp|B2VL84|CH60_ERWT9 60 kDa chaperonin OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=groL PE=3 SV=1 30 140 2.0E-07
sp|Q2SDG0|CH60_HAHCH 60 kDa chaperonin OS=Hahella chejuensis (strain KCTC 2396) GN=groL PE=3 SV=1 17 142 2.0E-07
sp|Q3IW60|CH602_RHOS4 60 kDa chaperonin 2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=groL2 PE=3 SV=1 16 231 2.0E-07
sp|B8GL19|CH60_THISH 60 kDa chaperonin OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=groL PE=3 SV=1 30 231 2.0E-07
sp|C5BP08|CH60_TERTT 60 kDa chaperonin OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=groL PE=3 SV=1 30 142 2.0E-07
sp|Q3J729|CH60_NITOC 60 kDa chaperonin OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=groL PE=3 SV=1 30 142 2.0E-07
sp|Q7M7I7|CH601_VIBVY 60 kDa chaperonin 1 OS=Vibrio vulnificus (strain YJ016) GN=groL1 PE=3 SV=1 30 134 2.0E-07
sp|Q9ALA9|CH601_VIBVU 60 kDa chaperonin 1 OS=Vibrio vulnificus (strain CMCP6) GN=groL1 PE=3 SV=2 30 134 2.0E-07
sp|Q391Y9|CH601_BURL3 60 kDa chaperonin 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=groL1 PE=3 SV=1 30 147 2.0E-07
sp|Q82GG6|CH602_STRAW 60 kDa chaperonin 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=groL2 PE=3 SV=1 12 131 2.0E-07
sp|Q6HPC7|CH60_BACHK 60 kDa chaperonin OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=groL PE=3 SV=1 30 231 2.0E-07
sp|Q63GV7|CH60_BACCZ 60 kDa chaperonin OS=Bacillus cereus (strain ZK / E33L) GN=groL PE=3 SV=1 30 231 2.0E-07
sp|B9J1H2|CH60_BACCQ 60 kDa chaperonin OS=Bacillus cereus (strain Q1) GN=groL PE=3 SV=1 30 231 2.0E-07
sp|B7HS05|CH60_BACC7 60 kDa chaperonin OS=Bacillus cereus (strain AH187) GN=groL PE=3 SV=1 30 231 2.0E-07
sp|C1EUB1|CH60_BACC3 60 kDa chaperonin OS=Bacillus cereus (strain 03BB102) GN=groL PE=3 SV=1 30 231 2.0E-07
sp|Q73ER9|CH60_BACC1 60 kDa chaperonin OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=groL PE=3 SV=2 30 231 2.0E-07
sp|B7JM60|CH60_BACC0 60 kDa chaperonin OS=Bacillus cereus (strain AH820) GN=groL PE=3 SV=1 30 231 2.0E-07
sp|A0R8W4|CH60_BACAH 60 kDa chaperonin OS=Bacillus thuringiensis (strain Al Hakam) GN=groL PE=3 SV=1 30 231 2.0E-07
sp|Q493W7|CH60_BLOPB 60 kDa chaperonin OS=Blochmannia pennsylvanicus (strain BPEN) GN=groL PE=3 SV=1 30 140 2.0E-07
sp|P97086|CH60_TSUTY 60 kDa chaperonin OS=Tsukamurella tyrosinosolvens GN=groL PE=3 SV=1 15 131 2.0E-07
sp|Q00768|CH602_STRAL 60 kDa chaperonin 2 OS=Streptomyces albus G GN=groL2 PE=1 SV=3 12 131 2.0E-07
sp|Q0ACQ9|CH60_ALKEH 60 kDa chaperonin OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=groL PE=3 SV=1 30 231 3.0E-07
sp|O66202|CH60_SERRU 60 kDa chaperonin (Fragment) OS=Serratia rubidaea GN=groL PE=3 SV=1 30 140 3.0E-07
sp|A4T2X3|CH601_MYCGI 60 kDa chaperonin 1 OS=Mycobacterium gilvum (strain PYR-GCK) GN=groL1 PE=3 SV=1 12 131 3.0E-07
sp|O66200|CH60_ENTAG 60 kDa chaperonin (Fragment) OS=Enterobacter agglomerans GN=groL PE=3 SV=1 30 140 3.0E-07
sp|B1XRX1|CH60_POLNS 60 kDa chaperonin OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=groL PE=3 SV=1 17 234 3.0E-07
sp|A9MFR9|CH60_SALAR 60 kDa chaperonin OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=groL PE=3 SV=1 30 140 3.0E-07
sp|A8MJJ7|CH60_ALKOO 60 kDa chaperonin OS=Alkaliphilus oremlandii (strain OhILAs) GN=groL PE=3 SV=1 11 132 3.0E-07
sp|Q81VE1|CH60_BACAN 60 kDa chaperonin OS=Bacillus anthracis GN=groL PE=3 SV=1 30 231 3.0E-07
sp|C3L507|CH60_BACAC 60 kDa chaperonin OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=groL PE=3 SV=1 30 231 3.0E-07
sp|C3PAV1|CH60_BACAA 60 kDa chaperonin OS=Bacillus anthracis (strain A0248) GN=groL PE=3 SV=1 30 231 3.0E-07
sp|Q7U348|CH60_BLOFL 60 kDa chaperonin OS=Blochmannia floridanus GN=groL PE=3 SV=1 30 140 3.0E-07
sp|Q5LV15|CH60_RUEPO 60 kDa chaperonin OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=groL PE=3 SV=1 10 231 3.0E-07
sp|A9BXL3|CH60_DELAS 60 kDa chaperonin OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=groL PE=3 SV=1 30 132 3.0E-07
sp|A5U892|CH602_MYCTA 60 kDa chaperonin 2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=groL2 PE=3 SV=1 12 116 3.0E-07
sp|A1KPA8|CH602_MYCBP 60 kDa chaperonin 2 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=groL2 PE=3 SV=1 12 116 3.0E-07
sp|P9WPE9|CH601_MYCTU 60 kDa chaperonin 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=groEL1 PE=1 SV=1 12 116 3.0E-07
sp|P9WPE8|CH601_MYCTO 60 kDa chaperonin 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=groEL1 PE=3 SV=1 12 116 3.0E-07
sp|P0A519|CH601_MYCBO 60 kDa chaperonin 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=groL1 PE=1 SV=1 12 116 3.0E-07
sp|Q7MAZ7|CH60_PHOLL 60 kDa chaperonin OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=groL PE=3 SV=1 30 140 3.0E-07
sp|A8AMQ6|CH60_CITK8 60 kDa chaperonin OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=groL PE=3 SV=1 30 140 3.0E-07
sp|A0M7D9|CH60_GRAFK 60 kDa chaperonin OS=Gramella forsetii (strain KT0803) GN=groL PE=3 SV=1 30 234 3.0E-07
sp|B9MLY9|CH60_CALBD 60 kDa chaperonin OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=groL PE=3 SV=1 3 126 3.0E-07
sp|A7MX54|CH60_VIBCB 60 kDa chaperonin OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=groL PE=3 SV=1 30 134 3.0E-07
sp|A0QQU5|CH601_MYCS2 60 kDa chaperonin 1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=groL1 PE=1 SV=1 12 144 3.0E-07
sp|A9VQG8|CH60_BACWK 60 kDa chaperonin OS=Bacillus weihenstephanensis (strain KBAB4) GN=groL PE=3 SV=1 30 231 3.0E-07
sp|Q98AX9|CH603_RHILO 60 kDa chaperonin 3 OS=Rhizobium loti (strain MAFF303099) GN=groL3 PE=3 SV=1 30 126 3.0E-07
sp|A6Q2B4|CH60_NITSB 60 kDa chaperonin OS=Nitratiruptor sp. (strain SB155-2) GN=groL PE=3 SV=1 30 231 3.0E-07
sp|B8D0Z4|CH60_HALOH 60 kDa chaperonin OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=groL PE=3 SV=1 30 231 3.0E-07
sp|Q1XDD8|CH60_PYRYE 60 kDa chaperonin, chloroplastic OS=Pyropia yezoensis GN=groL PE=3 SV=2 30 155 3.0E-07
sp|O66212|CH60_RAOPL 60 kDa chaperonin (Fragment) OS=Raoultella planticola GN=groL PE=3 SV=1 30 140 3.0E-07
sp|B5R991|CH60_SALG2 60 kDa chaperonin OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=groL PE=3 SV=1 30 140 3.0E-07
sp|P0C193|CH60_SODGL 60 kDa chaperonin OS=Sodalis glossinidius GN=groL PE=3 SV=1 30 140 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0008144 drug binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11042
MSAAQLLNPKAESRRRGEALKVNINAGVGLQDVLKSNLGPKGTIKMLVDGAGQIKLTKDGNVLLREMQIQNPTAV
MIARAATAQDDICGDGTTSVVLLVGELLKQADRYISEGLHPRIITDGFEIAKVEALKFLDSFKLPKEVDRELLLN
VARTSLATKLNATLAQKLTPDIVDAVLAIYQAPAKPDLHMVEIMKMQHRTASDTQLIKGLALDHGARHPDMPKRL
ENCYILTLNVSLEYEKTEINSGFFYSSAEQRDKLVESERRFIDAKLKKIVELKKELCGTDGKKNFVIINQKGIDP
LSLDVLAKNGILALRRAKRRNMERLQLICGGISQNSVDDLSPDVLGWAGLVYEQTLGEEKFTFVEEVRDPKSVTI
LIKGPNQHTISQLTDAVRDGLRSVYNMIVDKSVVPGAGAFQVACAAHLKSDLFSKTVKGKAKWGVEAFADALLII
PKTLAANAGHDIQDALAAMQDEHTEGAVVGLNLETGEPMDPELEGVFDSFRVLRNSIASSSSIASNLLLCDELLK
ARQMGRQGGPGPGMDGPEDHM*
Coding >Hirsu2|11042
ATGTCGGCTGCCCAGCTGCTTAACCCCAAGGCCGAGTCCCGCCGGAGGGGCGAGGCTCTCAAGGTCAACATCAAT
GCCGGCGTGGGCTTGCAGGACGTGCTCAAGTCCAATCTAGGGCCCAAGGGAACGATAAAGATGCTCGTCGACGGT
GCTGGACAGATCAAGCTTACCAAGGACGGCAATGTGCTTCTGCGAGAGATGCAGATCCAGAACCCCACTGCGGTC
ATGATCGCTCGAGCCGCGACTGCGCAAGACGACATCTGCGGAGACGGCACCACGTCCGTCGTACTCCTGGTCGGC
GAGCTGCTGAAGCAGGCAGACAGATACATCTCAGAGGGGCTGCATCCCCGTATAATCACTGATGGCTTCGAAATT
GCCAAAGTGGAGGCGCTCAAGTTCCTCGACTCGTTCAAGCTGCCCAAGGAGGTCGACCGGGAATTGCTCCTCAAC
GTTGCGCGCACGTCGCTGGCCACGAAGCTCAACGCAACCCTAGCGCAGAAGCTCACGCCCGACATTGTCGACGCC
GTGCTCGCCATCTACCAAGCGCCCGCCAAGCCCGACCTGCACATGGTGGAGATCATGAAGATGCAGCATCGTACA
GCCTCGGACACGCAGCTCATCAAGGGGCTTGCCCTGGATCATGGCGCCCGGCACCCGGACATGCCGAAGCGTCTG
GAGAACTGCTACATCCTCACTCTCAACGTCAGTCTCGAGTACGAGAAGACGGAAATCAACTCGGGCTTCTTCTAC
TCGAGCGCCGAACAGCGCGACAAGCTGGTCGAGAGCGAGCGCCGCTTCATCGACGCCAAGCTCAAGAAGATTGTC
GAGCTGAAGAAGGAGCTGTGCGGCACGGACGGCAAGAAGAATTTTGTCATCATCAACCAGAAGGGCATCGACCCC
CTGTCCCTGGACGTGCTGGCCAAGAACGGCATCCTGGCTCTTCGGCGGGCCAAGCGGAGGAATATGGAGCGCCTG
CAGCTGATATGCGGCGGCATCAGCCAGAACAGCGTCGACGACCTCTCTCCCGACGTCCTCGGCTGGGCCGGCCTT
GTCTATGAGCAGACGCTGGGCGAGGAGAAGTTCACCTTCGTCGAGGAGGTCCGGGACCCCAAGTCCGTCACCATT
CTCATCAAGGGCCCCAACCAGCACACAATTTCCCAGCTCACGGACGCTGTCAGGGACGGGCTGAGGAGCGTCTAC
AACATGATTGTCGACAAGAGCGTCGTGCCGGGCGCCGGCGCGTTCCAGGTCGCCTGCGCGGCCCACCTCAAGAGT
GACCTTTTCTCCAAGACGGTCAAGGGCAAGGCAAAATGGGGCGTGGAAGCGTTTGCCGATGCGCTGCTCATCATC
CCCAAGACCCTGGCTGCCAACGCCGGACACGACATCCAGGATGCCCTCGCCGCCATGCAGGACGAGCACACCGAG
GGCGCCGTGGTCGGGCTCAACCTGGAGACGGGCGAGCCCATGGACCCCGAGCTCGAGGGCGTTTTTGACTCGTTC
AGAGTGCTGAGAAACTCGATCGCGTCCAGCTCGAGCATTGCGTCGAACCTGTTGCTGTGCGACGAGTTGTTGAAG
GCTCGACAGATGGGCCGCCAAGGCGGTCCGGGCCCGGGCATGGACGGACCCGAGGACCACATGTAG
Transcript >Hirsu2|11042
ATGTCGGCTGCCCAGCTGCTTAACCCCAAGGCCGAGTCCCGCCGGAGGGGCGAGGCTCTCAAGGTCAACATCAAT
GCCGGCGTGGGCTTGCAGGACGTGCTCAAGTCCAATCTAGGGCCCAAGGGAACGATAAAGATGCTCGTCGACGGT
GCTGGACAGATCAAGCTTACCAAGGACGGCAATGTGCTTCTGCGAGAGATGCAGATCCAGAACCCCACTGCGGTC
ATGATCGCTCGAGCCGCGACTGCGCAAGACGACATCTGCGGAGACGGCACCACGTCCGTCGTACTCCTGGTCGGC
GAGCTGCTGAAGCAGGCAGACAGATACATCTCAGAGGGGCTGCATCCCCGTATAATCACTGATGGCTTCGAAATT
GCCAAAGTGGAGGCGCTCAAGTTCCTCGACTCGTTCAAGCTGCCCAAGGAGGTCGACCGGGAATTGCTCCTCAAC
GTTGCGCGCACGTCGCTGGCCACGAAGCTCAACGCAACCCTAGCGCAGAAGCTCACGCCCGACATTGTCGACGCC
GTGCTCGCCATCTACCAAGCGCCCGCCAAGCCCGACCTGCACATGGTGGAGATCATGAAGATGCAGCATCGTACA
GCCTCGGACACGCAGCTCATCAAGGGGCTTGCCCTGGATCATGGCGCCCGGCACCCGGACATGCCGAAGCGTCTG
GAGAACTGCTACATCCTCACTCTCAACGTCAGTCTCGAGTACGAGAAGACGGAAATCAACTCGGGCTTCTTCTAC
TCGAGCGCCGAACAGCGCGACAAGCTGGTCGAGAGCGAGCGCCGCTTCATCGACGCCAAGCTCAAGAAGATTGTC
GAGCTGAAGAAGGAGCTGTGCGGCACGGACGGCAAGAAGAATTTTGTCATCATCAACCAGAAGGGCATCGACCCC
CTGTCCCTGGACGTGCTGGCCAAGAACGGCATCCTGGCTCTTCGGCGGGCCAAGCGGAGGAATATGGAGCGCCTG
CAGCTGATATGCGGCGGCATCAGCCAGAACAGCGTCGACGACCTCTCTCCCGACGTCCTCGGCTGGGCCGGCCTT
GTCTATGAGCAGACGCTGGGCGAGGAGAAGTTCACCTTCGTCGAGGAGGTCCGGGACCCCAAGTCCGTCACCATT
CTCATCAAGGGCCCCAACCAGCACACAATTTCCCAGCTCACGGACGCTGTCAGGGACGGGCTGAGGAGCGTCTAC
AACATGATTGTCGACAAGAGCGTCGTGCCGGGCGCCGGCGCGTTCCAGGTCGCCTGCGCGGCCCACCTCAAGAGT
GACCTTTTCTCCAAGACGGTCAAGGGCAAGGCAAAATGGGGCGTGGAAGCGTTTGCCGATGCGCTGCTCATCATC
CCCAAGACCCTGGCTGCCAACGCCGGACACGACATCCAGGATGCCCTCGCCGCCATGCAGGACGAGCACACCGAG
GGCGCCGTGGTCGGGCTCAACCTGGAGACGGGCGAGCCCATGGACCCCGAGCTCGAGGGCGTTTTTGACTCGTTC
AGAGTGCTGAGAAACTCGATCGCGTCCAGCTCGAGCATTGCGTCGAACCTGTTGCTGTGCGACGAGTTGTTGAAG
GCTCGACAGATGGGCCGCCAAGGCGGTCCGGGCCCGGGCATGGACGGACCCGAGGACCACATGTAG
Gene >Hirsu2|11042
ATGTCGGCTGCCCAGCTGCTTAACCCCAAGGCCGAGTCCCGCGTACGTCCCCCGAACCTGATCTTCCGCGCCCGC
CTGTCTGTGCGTGCTCCTGACAGGCTGTGTAGCGGAGGGGCGAGGCTCTCAAGGTCAACATCAATGCCGGCGTGG
GCTTGCAGGACGTGCTCAAGTCCAATCTAGGGCCCAAGGGAACGATAAAGATGTGAGAAAACATGTCTTCTCTGG
GCCCCGGCCGACGTACCACCTACTGACTGCACCCCTCTCCTAGGCTCGTCGACGGTGCTGGACAGGTGCTGCTTC
TCGTCCCCTCCGGCCCCTTCACCCACTGACCTGCTGACGGCTGCAAAAGATCAAGCTTACCAAGGACGGCAATGT
GCTTCTGCGAGAGATGCAGATCCAGAACCCCACTGCGGTCATGATCGCTCGAGCCGCGACTGCGCAAGACGACAT
CTGCGGAGACGGCACCACGTCCGTCGTACTCCTGGTCGGCGAGCTGCTGAAGCAGGCAGACAGATACATCTCAGA
GGGGCTGCATCCCCGTATAATCACTGATGGCTTCGAAATTGCCAAAGTGGAGGCGCTCAAGGTTCGTCACTCGAT
GCGTTGCTTGCGATATGCGTACATGTCTGACAGGCCGGTCGCCGTGCTCTAGTTCCTCGACTCGTTCAAGCTGCC
CAAGGAGGTCGACCGGGAATTGCTCCTCAACGTTGCGCGCACGTCGCTGGCCACGAAGCTCAACGCAACCCTAGC
GCAGAAGCTCACGCCCGACATTGTCGACGCCGTGCTCGCCATCTACCAAGCGCCCGCCAAGCCCGACCTGCACAT
GGTGGAGATCATGAAGATGCAGCATCGTACAGCCTCGGACACGCAGCTCATCAAGGGGCTTGCCCTGGATCATGG
CGCCCGGCACCCGGACATGCCGAAGCGTCTGGAGAACTGCTACATCCTCACTCTCAACGTCAGTCTCGAGTACGA
GAAGACGGAAATCAACTCGGGCTTCTTCTACTCGAGCGCCGAACAGCGCGACAAGCTGGTCGAGAGCGAGCGCCG
CTTCATCGACGCCAAGCTCAAGAAGATTGTCGAGCTGAAGAAGGAGCTGTGCGGCACGGACGGCAAGAAGAATTT
TGTCATCATCAACCAGAAGGGCATCGACCCCCTGTCCCTGGACGTGCTGGCCAAGAACGGCATCCTGGCTCTTCG
GCGGGCCAAGCGGAGGAATATGGAGCGCCTGCAGCTGATATGCGGCGGCATCAGCCAGAACAGCGTCGACGACCT
CTCTCCCGACGTCCTCGGCTGGGCCGGCCTTGTCTATGAGCAGACGCTGGGCGAGGAGAAGTTCACCTTCGTCGA
GGAGGTCCGGGACCCCAAGTCCGTCACCATTCTCATCAAGGGCCCCAACCAGCACACAATTTCCCAGCTCACGGA
CGCTGTCAGGGACGGGCTGAGGAGCGTCTACAACATGATTGTCGACAAGAGCGTCGTGCCGGGCGCCGGCGCGTT
CCAGGTCGCCTGCGCGGCCCACCTCAAGAGTGACCTTTTCTCCAAGACGGTCAAGGGCAAGGCAAAATGGGGCGT
GGAAGCGTTTGCCGATGCGCTGCTCATCATCCCCAAGACCCTGGCTGCCAACGCCGGACACGACATCCAGGATGC
CCGTAAGTAACGCCCGGCTCTCCCCGTCTTCCCAATTTCGTCATTTTTTTTTCTTCCGAGTCGGTTGCTGACAGG
ATCGTACAGTCGCCGCCATGCAGGACGAGCACACCGAGGGCGCCGTGGTCGGGCTCAACCTGGAGACGGGCGAGC
CCATGGACCCCGAGCTCGAGGGCGTTTTTGACTCGTTCAGAGTGCTGAGAAACTCGATCGCGTCCAGCTCGAGCA
TTGCGTCGAACCTGTTGCTGTGCGACGAGTTGTTGAAGGCTCGACAGATGGGCCGCCAAGGCGGTCCGGGCCCGG
GCATGGACGGACCCGAGGACCACATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail