Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11041
Gene name
LocationContig_951:2273..4091
Strand+
Gene length (bp)1818
Transcript length (bp)1761
Coding sequence length (bp)1761
Protein length (aa) 587

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 1.7E-23 150 268
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 5.3E-11 437 518
PF08022 FAD_binding_8 FAD-binding domain 8.4E-06 319 428

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36033|FRE2_YEAST Ferric/cupric reductase transmembrane component 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE2 PE=1 SV=1 87 586 1.0E-40
sp|Q08905|FRE3_YEAST Ferric reductase transmembrane component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE3 PE=1 SV=1 79 586 1.0E-39
sp|P53746|FRE4_YEAST Ferric reductase transmembrane component 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE4 PE=2 SV=1 84 586 7.0E-32
sp|Q08908|FRE5_YEAST Ferric reductase transmembrane component 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE5 PE=2 SV=1 93 586 1.0E-30
sp|P78588|FREL_CANAX Probable ferric reductase transmembrane component OS=Candida albicans GN=CFL1 PE=3 SV=1 79 568 1.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36033|FRE2_YEAST Ferric/cupric reductase transmembrane component 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE2 PE=1 SV=1 87 586 1.0E-40
sp|Q08905|FRE3_YEAST Ferric reductase transmembrane component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE3 PE=1 SV=1 79 586 1.0E-39
sp|P53746|FRE4_YEAST Ferric reductase transmembrane component 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE4 PE=2 SV=1 84 586 7.0E-32
sp|Q08908|FRE5_YEAST Ferric reductase transmembrane component 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE5 PE=2 SV=1 93 586 1.0E-30
sp|P78588|FREL_CANAX Probable ferric reductase transmembrane component OS=Candida albicans GN=CFL1 PE=3 SV=1 79 568 1.0E-27
sp|Q12473|FRE6_YEAST Ferric reductase transmembrane component 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE6 PE=1 SV=1 79 586 1.0E-27
sp|Q5A446|FRE1_CANAL Ferric/cupric reductase transmembrane component 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CFL1 PE=2 SV=1 79 568 1.0E-27
sp|P32791|FRE1_YEAST Ferric/cupric reductase transmembrane component 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE1 PE=1 SV=1 147 586 2.0E-26
sp|O94727|FRP2_SCHPO Ferric/cupric reductase transmembrane component 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frp2 PE=3 SV=1 91 569 7.0E-12
sp|Q9ES45|DUOX2_RAT Dual oxidase 2 OS=Rattus norvegicus GN=Duox2 PE=2 SV=1 146 580 2.0E-10
sp|Q12333|FRE7_YEAST Ferric/cupric reductase transmembrane component 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE7 PE=1 SV=2 148 530 2.0E-10
sp|P92949|FRO2_ARATH Ferric reduction oxidase 2 OS=Arabidopsis thaliana GN=FRO2 PE=1 SV=2 148 522 2.0E-10
sp|A6ZN61|FRE7_YEAS7 Ferric/cupric reductase transmembrane component 7 OS=Saccharomyces cerevisiae (strain YJM789) GN=FRE7 PE=3 SV=1 148 530 7.0E-10
sp|Q8HZK2|DUOX2_PIG Dual oxidase 2 OS=Sus scrofa GN=DUOX2 PE=1 SV=2 119 580 2.0E-09
sp|Q8RWS6|FRO6_ARATH Ferric reduction oxidase 6 OS=Arabidopsis thaliana GN=FRO6 PE=2 SV=1 137 517 2.0E-09
sp|F4I4K7|FRO3_ARATH Ferric reduction oxidase 3, mitochondrial OS=Arabidopsis thaliana GN=FRO3 PE=2 SV=1 165 514 2.0E-08
sp|Q3KTM0|FRO7_ARATH Ferric reduction oxidase 7, chloroplastic OS=Arabidopsis thaliana GN=FRO7 PE=2 SV=1 137 516 3.0E-08
sp|C8Z891|AIM14_YEAS8 Probable metalloreductase AIM14 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=AIM14 PE=3 SV=1 184 511 9.0E-08
sp|P53109|AIM14_YEAST Probable metalloreductase AIM14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM14 PE=1 SV=1 184 511 1.0E-07
sp|Q9FLW2|FRO5_ARATH Ferric reduction oxidase 5 OS=Arabidopsis thaliana GN=FRO5 PE=2 SV=1 37 512 1.0E-07
sp|Q8W110|FRO4_ARATH Ferric reduction oxidase 4 OS=Arabidopsis thaliana GN=FRO4 PE=2 SV=1 166 512 2.0E-07
sp|B3LHL3|AIM14_YEAS1 Probable metalloreductase AIM14 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=AIM14 PE=3 SV=1 184 511 2.0E-07
sp|A6ZU25|AIM14_YEAS7 Probable metalloreductase AIM14 OS=Saccharomyces cerevisiae (strain YJM789) GN=AIM14 PE=3 SV=1 184 511 2.0E-07
sp|C7GPP6|AIM14_YEAS2 Probable metalloreductase AIM14 OS=Saccharomyces cerevisiae (strain JAY291) GN=AIM14 PE=3 SV=1 184 491 4.0E-07
sp|Q9NRD9|DUOX1_HUMAN Dual oxidase 1 OS=Homo sapiens GN=DUOX1 PE=1 SV=1 319 579 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.5

Transmembrane Domains

Domain # Start End Length
1 27 49 22
2 115 137 22
3 152 174 22
4 187 209 22
5 224 243 19
6 250 272 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11041
MDPTPSLQIREADGSREEPLNMLFKDVLWWTLGIVALIVLTIRILEILWAKLRQVSAMSQPRDKQGYWRISQWSW
MPPLKKHLTYAPLLRKRHNREFRLSSAVNVGTLPSRLHSLLLFLYLASNTAYMFVLDWSVANKFALCAELRGRSG
TLSVVNMIPLVILAGRNNPLIPLLKISFDTYNLLHRWIGRVVVAEVIIHTVAWAIPAVAHKGWSAAFGAAVKSVF
IGSGFWAAVAMTLLLLLSLSPIRHAFYETFLNTHIILAVVALGGTWIHCSSASLPPLPWAIAVVALWMADRLARV
LRLVFTNWSNRGVTDALCEALPGEVTRVTLQLPRYVRIEPGTHAYLRFWGVRPWESHPFSIAWVEYQAANALPTS
EKEPLTAVDRKTASTSVSFIIGAQTGMTRLLYDRASKSPAGVRLRAAMEGPYAGHHNLDSYGHVVLFAGSTGITH
QISHVRHLLDGYNEGMVATRRLTLVWIIRTYETLEWVRPYMDMILRIPNRKDILRIQVFVTRPQNPRDIVSASST
VKMFPGRPNIPLLLVKEVQDQIGAMSVSVCGPGGLADDVRGAVRAVQGDSVIDFIEESFTW*
Coding >Hirsu2|11041
ATGGATCCCACCCCGTCACTCCAGATCCGTGAGGCCGATGGCTCTCGGGAAGAGCCCTTGAACATGCTCTTCAAA
GATGTCCTCTGGTGGACGCTGGGCATCGTCGCCCTGATTGTTCTGACCATCAGGATCCTGGAGATCCTGTGGGCC
AAGCTTCGCCAGGTCTCGGCCATGTCGCAGCCGCGCGACAAGCAGGGCTACTGGAGGATCTCGCAATGGAGCTGG
ATGCCGCCCCTCAAGAAGCACCTCACCTACGCCCCGTTGCTGAGGAAGCGCCACAACCGTGAGTTTCGCCTGTCG
TCGGCCGTGAATGTCGGCACCCTGCCCTCGCGCCTGCACTCGCTGCTGCTCTTCCTCTACCTCGCCAGCAATACG
GCCTACATGTTCGTCCTCGACTGGTCTGTCGCCAACAAGTTCGCCCTCTGCGCCGAGCTGCGCGGCCGCTCCGGC
ACCCTCTCCGTCGTCAACATGATCCCCCTCGTCATCCTGGCCGGCCGCAACAACCCCCTGATTCCGCTGCTCAAA
ATCAGCTTTGACACGTATAACCTGCTGCATCGCTGGATTGGCCGCGTCGTCGTTGCCGAGGTCATCATCCACACC
GTCGCCTGGGCCATCCCGGCCGTCGCCCACAAGGGCTGGTCGGCCGCCTTTGGCGCCGCCGTCAAGAGCGTCTTC
ATCGGCTCCGGCTTCTGGGCCGCCGTCGCCATGACGCTCCTGCTCCTGCTCTCCCTCTCCCCCATCCGCCACGCC
TTTTACGAGACCTTCCTCAACACGCACATCATCCTGGCCGTCGTCGCCCTCGGCGGCACCTGGATCCACTGCTCC
TCGGCCTCGCTCCCGCCCCTGCCCTGGGCCATCGCCGTCGTGGCCCTGTGGATGGCGGACCGGCTCGCCCGCGTC
CTCCGCCTCGTCTTCACTAACTGGTCCAACAGGGGTGTGACGGACGCGCTCTGCGAGGCCTTGCCCGGCGAGGTG
ACGCGCGTCACGCTGCAGCTCCCGCGCTACGTCCGCATCGAGCCCGGCACGCACGCCTACCTGCGCTTCTGGGGC
GTCCGCCCGTGGGAGAGCCACCCCTTCTCCATCGCCTGGGTCGAGTACCAGGCCGCCAACGCGCTGCCCACGTCG
GAGAAGGAGCCGCTCACCGCCGTGGACCGTAAAACGGCCTCGACCTCGGTCTCCTTCATCATCGGCGCCCAGACG
GGCATGACGCGCCTGCTCTACGACCGCGCCAGCAAGTCGCCCGCCGGCGTCCGGCTGCGGGCCGCCATGGAGGGT
CCCTACGCCGGCCACCACAACCTCGACTCGTACGGCCACGTCGTTCTCTTTGCCGGCTCGACGGGCATCACGCAC
CAGATTTCGCACGTCCGCCACCTGCTCGACGGCTACAACGAGGGCATGGTGGCGACGCGGAGGCTCACGCTCGTG
TGGATCATCCGGACCTACGAGACGCTCGAGTGGGTGCGTCCGTACATGGACATGATCCTGCGGATACCCAACCGC
AAGGACATCCTGCGCATCCAGGTCTTCGTCACCCGGCCGCAGAACCCGCGCGACATCGTCAGCGCCAGCTCCACG
GTCAAGATGTTCCCCGGACGGCCCAACATTCCGCTGCTCCTGGTCAAGGAGGTGCAGGACCAGATCGGCGCCATG
TCGGTGAGCGTGTGCGGGCCCGGCGGCCTGGCCGACGACGTGCGCGGCGCCGTCCGCGCTGTACAGGGCGACTCC
GTCATCGACTTCATCGAAGAGAGCTTTACGTGGTGA
Transcript >Hirsu2|11041
ATGGATCCCACCCCGTCACTCCAGATCCGTGAGGCCGATGGCTCTCGGGAAGAGCCCTTGAACATGCTCTTCAAA
GATGTCCTCTGGTGGACGCTGGGCATCGTCGCCCTGATTGTTCTGACCATCAGGATCCTGGAGATCCTGTGGGCC
AAGCTTCGCCAGGTCTCGGCCATGTCGCAGCCGCGCGACAAGCAGGGCTACTGGAGGATCTCGCAATGGAGCTGG
ATGCCGCCCCTCAAGAAGCACCTCACCTACGCCCCGTTGCTGAGGAAGCGCCACAACCGTGAGTTTCGCCTGTCG
TCGGCCGTGAATGTCGGCACCCTGCCCTCGCGCCTGCACTCGCTGCTGCTCTTCCTCTACCTCGCCAGCAATACG
GCCTACATGTTCGTCCTCGACTGGTCTGTCGCCAACAAGTTCGCCCTCTGCGCCGAGCTGCGCGGCCGCTCCGGC
ACCCTCTCCGTCGTCAACATGATCCCCCTCGTCATCCTGGCCGGCCGCAACAACCCCCTGATTCCGCTGCTCAAA
ATCAGCTTTGACACGTATAACCTGCTGCATCGCTGGATTGGCCGCGTCGTCGTTGCCGAGGTCATCATCCACACC
GTCGCCTGGGCCATCCCGGCCGTCGCCCACAAGGGCTGGTCGGCCGCCTTTGGCGCCGCCGTCAAGAGCGTCTTC
ATCGGCTCCGGCTTCTGGGCCGCCGTCGCCATGACGCTCCTGCTCCTGCTCTCCCTCTCCCCCATCCGCCACGCC
TTTTACGAGACCTTCCTCAACACGCACATCATCCTGGCCGTCGTCGCCCTCGGCGGCACCTGGATCCACTGCTCC
TCGGCCTCGCTCCCGCCCCTGCCCTGGGCCATCGCCGTCGTGGCCCTGTGGATGGCGGACCGGCTCGCCCGCGTC
CTCCGCCTCGTCTTCACTAACTGGTCCAACAGGGGTGTGACGGACGCGCTCTGCGAGGCCTTGCCCGGCGAGGTG
ACGCGCGTCACGCTGCAGCTCCCGCGCTACGTCCGCATCGAGCCCGGCACGCACGCCTACCTGCGCTTCTGGGGC
GTCCGCCCGTGGGAGAGCCACCCCTTCTCCATCGCCTGGGTCGAGTACCAGGCCGCCAACGCGCTGCCCACGTCG
GAGAAGGAGCCGCTCACCGCCGTGGACCGTAAAACGGCCTCGACCTCGGTCTCCTTCATCATCGGCGCCCAGACG
GGCATGACGCGCCTGCTCTACGACCGCGCCAGCAAGTCGCCCGCCGGCGTCCGGCTGCGGGCCGCCATGGAGGGT
CCCTACGCCGGCCACCACAACCTCGACTCGTACGGCCACGTCGTTCTCTTTGCCGGCTCGACGGGCATCACGCAC
CAGATTTCGCACGTCCGCCACCTGCTCGACGGCTACAACGAGGGCATGGTGGCGACGCGGAGGCTCACGCTCGTG
TGGATCATCCGGACCTACGAGACGCTCGAGTGGGTGCGTCCGTACATGGACATGATCCTGCGGATACCCAACCGC
AAGGACATCCTGCGCATCCAGGTCTTCGTCACCCGGCCGCAGAACCCGCGCGACATCGTCAGCGCCAGCTCCACG
GTCAAGATGTTCCCCGGACGGCCCAACATTCCGCTGCTCCTGGTCAAGGAGGTGCAGGACCAGATCGGCGCCATG
TCGGTGAGCGTGTGCGGGCCCGGCGGCCTGGCCGACGACGTGCGCGGCGCCGTCCGCGCTGTACAGGGCGACTCC
GTCATCGACTTCATCGAAGAGAGCTTTACGTGGTGA
Gene >Hirsu2|11041
ATGGATCCCACCCCGTCACTCCAGATCCGTGAGGCCGATGGCTCTCGGGAAGAGGTACAGCCCAGTTCGACAATT
GCCCCGTATTACACGGCGCTAAATGGTGTGAATCAGCCCTTGAACATGCTCTTCAAAGATGTCCTCTGGTGGACG
CTGGGCATCGTCGCCCTGATTGTTCTGACCATCAGGATCCTGGAGATCCTGTGGGCCAAGCTTCGCCAGGTCTCG
GCCATGTCGCAGCCGCGCGACAAGCAGGGCTACTGGAGGATCTCGCAATGGAGCTGGATGCCGCCCCTCAAGAAG
CACCTCACCTACGCCCCGTTGCTGAGGAAGCGCCACAACCGTGAGTTTCGCCTGTCGTCGGCCGTGAATGTCGGC
ACCCTGCCCTCGCGCCTGCACTCGCTGCTGCTCTTCCTCTACCTCGCCAGCAATACGGCCTACATGTTCGTCCTC
GACTGGTCTGTCGCCAACAAGTTCGCCCTCTGCGCCGAGCTGCGCGGCCGCTCCGGCACCCTCTCCGTCGTCAAC
ATGATCCCCCTCGTCATCCTGGCCGGCCGCAACAACCCCCTGATTCCGCTGCTCAAAATCAGCTTTGACACGTAT
AACCTGCTGCATCGCTGGATTGGCCGCGTCGTCGTTGCCGAGGTCATCATCCACACCGTCGCCTGGGCCATCCCG
GCCGTCGCCCACAAGGGCTGGTCGGCCGCCTTTGGCGCCGCCGTCAAGAGCGTCTTCATCGGCTCCGGCTTCTGG
GCCGCCGTCGCCATGACGCTCCTGCTCCTGCTCTCCCTCTCCCCCATCCGCCACGCCTTTTACGAGACCTTCCTC
AACACGCACATCATCCTGGCCGTCGTCGCCCTCGGCGGCACCTGGATCCACTGCTCCTCGGCCTCGCTCCCGCCC
CTGCCCTGGGCCATCGCCGTCGTGGCCCTGTGGATGGCGGACCGGCTCGCCCGCGTCCTCCGCCTCGTCTTCACT
AACTGGTCCAACAGGGGTGTGACGGACGCGCTCTGCGAGGCCTTGCCCGGCGAGGTGACGCGCGTCACGCTGCAG
CTCCCGCGCTACGTCCGCATCGAGCCCGGCACGCACGCCTACCTGCGCTTCTGGGGCGTCCGCCCGTGGGAGAGC
CACCCCTTCTCCATCGCCTGGGTCGAGTACCAGGCCGCCAACGCGCTGCCCACGTCGGAGAAGGAGCCGCTCACC
GCCGTGGACCGTAAAACGGCCTCGACCTCGGTCTCCTTCATCATCGGCGCCCAGACGGGCATGACGCGCCTGCTC
TACGACCGCGCCAGCAAGTCGCCCGCCGGCGTCCGGCTGCGGGCCGCCATGGAGGGTCCCTACGCCGGCCACCAC
AACCTCGACTCGTACGGCCACGTCGTTCTCTTTGCCGGCTCGACGGGCATCACGCACCAGATTTCGCACGTCCGC
CACCTGCTCGACGGCTACAACGAGGGCATGGTGGCGACGCGGAGGCTCACGCTCGTGTGGATCATCCGGACCTAC
GAGACGCTCGAGTGGGTGCGTCCGTACATGGACATGATCCTGCGGATACCCAACCGCAAGGACATCCTGCGCATC
CAGGTCTTCGTCACCCGGCCGCAGAACCCGCGCGACATCGTCAGCGCCAGCTCCACGGTCAAGATGTTCCCCGGA
CGGCCCAACATTCCGCTGCTCCTGGTCAAGGAGGTGCAGGACCAGATCGGCGCCATGTCGGTGAGCGTGTGCGGG
CCCGGCGGCCTGGCCGACGACGTGCGCGGCGCCGTCCGCGCTGTACAGGGCGACTCCGTCATCGACTTCATCGAA
GAGAGCTTTACGTGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail