Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11034
Gene name
LocationContig_95:20407..23792
Strand-
Gene length (bp)3385
Transcript length (bp)3168
Coding sequence length (bp)3168
Protein length (aa) 1056

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 3.5E-48 537 725
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 6.0E-24 744 951
PF00403 HMA Heavy-metal-associated domain 6.1E-09 259 319

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38360|ATU1_YEAST P-type cation-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCA1 PE=1 SV=2 125 1050 0.0E+00
sp|Q4L970|COPA_STAHJ Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 255 1052 8.0E-101
sp|Q4A0G1|COPA_STAS1 Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1 255 1052 1.0E-100
sp|Q7A3E6|COPA_STAAN Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 259 1052 3.0E-98
sp|Q99R80|COPA_STAAM Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 259 1052 3.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38360|ATU1_YEAST P-type cation-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCA1 PE=1 SV=2 125 1050 0.0E+00
sp|Q4L970|COPA_STAHJ Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 255 1052 8.0E-101
sp|Q4A0G1|COPA_STAS1 Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1 255 1052 1.0E-100
sp|Q7A3E6|COPA_STAAN Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 259 1052 3.0E-98
sp|Q99R80|COPA_STAAM Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 259 1052 3.0E-98
sp|A5IVY3|COPA_STAA9 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 259 1052 3.0E-98
sp|A6U4T8|COPA_STAA2 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 259 1052 3.0E-98
sp|A7X6S1|COPA_STAA1 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=copA PE=3 SV=1 259 1052 3.0E-98
sp|Q8NUQ9|COPA_STAAW Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MW2) GN=copA PE=3 SV=1 259 1052 2.0E-97
sp|Q6G6B7|COPA_STAAS Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MSSA476) GN=copA PE=3 SV=1 259 1052 2.0E-97
sp|A6QK47|COPA_STAAE Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Newman) GN=copA PE=3 SV=1 259 1052 4.0E-97
sp|Q5HCZ3|COPA_STAAC Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain COL) GN=copA PE=3 SV=1 259 1052 4.0E-97
sp|Q2FV64|COPA_STAA8 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain NCTC 8325) GN=copA PE=1 SV=1 259 1052 4.0E-97
sp|A8Z3F8|COPA_STAAT Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copA PE=3 SV=1 259 1052 4.0E-97
sp|Q2FDV0|COPA_STAA3 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300) GN=copA PE=3 SV=1 259 1052 4.0E-97
sp|Q9S7J8|HMA7_ARATH Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 259 1028 2.0E-96
sp|Q2YWA3|COPA_STAAB Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=copA PE=3 SV=1 259 1052 4.0E-96
sp|Q6GDP1|COPA_STAAR Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MRSA252) GN=copA PE=3 SV=1 259 1052 9.0E-96
sp|Q8CN02|COPA_STAES Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1 257 1052 5.0E-95
sp|Q5HL56|COPA_STAEQ Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1 257 1052 5.0E-95
sp|Q9SH30|HMA5_ARATH Probable copper-transporting ATPase HMA5 OS=Arabidopsis thaliana GN=HMA5 PE=1 SV=2 259 1051 3.0E-94
sp|P35670|ATP7B_HUMAN Copper-transporting ATPase 2 OS=Homo sapiens GN=ATP7B PE=1 SV=4 259 1022 6.0E-92
sp|Q9XT50|ATP7B_SHEEP Copper-transporting ATPase 2 OS=Ovis aries GN=ATP7B PE=2 SV=1 259 1020 2.0E-90
sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=actP PE=1 SV=1 259 1020 8.0E-89
sp|Q64446|ATP7B_MOUSE Copper-transporting ATPase 2 OS=Mus musculus GN=Atp7b PE=1 SV=2 259 1022 1.0E-88
sp|Q64535|ATP7B_RAT Copper-transporting ATPase 2 OS=Rattus norvegicus GN=Atp7b PE=1 SV=1 259 1022 2.0E-88
sp|P32113|COPA_ENTHA Probable copper-importing P-type ATPase A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copA PE=1 SV=2 400 1051 7.0E-88
sp|P58341|ATCU1_RHIME Copper-transporting ATPase 1 OS=Rhizobium meliloti (strain 1021) GN=actP1 PE=3 SV=1 259 1017 8.0E-88
sp|Q04656|ATP7A_HUMAN Copper-transporting ATPase 1 OS=Homo sapiens GN=ATP7A PE=1 SV=3 239 1020 9.0E-88
sp|P70705|ATP7A_RAT Copper-transporting ATPase 1 OS=Rattus norvegicus GN=Atp7a PE=1 SV=1 259 1020 1.0E-87
sp|Q64430|ATP7A_MOUSE Copper-transporting ATPase 1 OS=Mus musculus GN=Atp7a PE=1 SV=3 259 1020 5.0E-87
sp|P37279|ATCS_SYNE7 Probable copper-transporting ATPase PacS OS=Synechococcus elongatus (strain PCC 7942) GN=pacS PE=3 SV=2 454 1045 3.0E-86
sp|P73241|ATCS_SYNY3 Probable copper-transporting ATPase PacS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pacS PE=1 SV=1 255 1050 1.0E-85
sp|P49015|ATP7A_CRIGR Copper-transporting ATPase 1 (Fragment) OS=Cricetulus griseus GN=ATP7A PE=2 SV=1 259 1020 9.0E-85
sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti (strain 1021) GN=actP2 PE=3 SV=1 248 1020 1.0E-84
sp|O32220|COPA_BACSU Copper-exporting P-type ATPase A OS=Bacillus subtilis (strain 168) GN=copA PE=1 SV=2 255 1051 6.0E-83
sp|O59666|ATU2_SCHPO Copper-transporting ATPase ccc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccc2 PE=3 SV=1 259 1027 2.0E-80
sp|O30085|COPB_ARCFU Copper-exporting P-type ATPase B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copB PE=1 SV=1 400 1044 1.0E-77
sp|O29777|COPA_ARCFU Probable copper-exporting P-type ATPase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copA PE=1 SV=1 409 1048 8.0E-77
sp|O32619|COPA_HELFC Copper-transporting ATPase OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=copA PE=3 SV=1 422 1045 1.0E-76
sp|Q9ZHC7|SILP_SALTM Silver exporting P-type ATPase OS=Salmonella typhimurium GN=silP PE=1 SV=1 403 1054 1.0E-75
sp|P9WPS3|CTPV_MYCTU Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpV PE=1 SV=1 467 1014 1.0E-71
sp|P9WPS2|CTPV_MYCTO Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpV PE=3 SV=1 467 1014 1.0E-71
sp|P38995|ATU2_YEAST Copper-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCC2 PE=1 SV=1 259 1029 8.0E-71
sp|Q8ZR95|COPA_SALTY Copper-exporting P-type ATPase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=copA PE=1 SV=3 409 1051 2.0E-69
sp|Q69HU0|COPB_STAAU Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus GN=copB PE=3 SV=1 409 1048 2.0E-69
sp|Q6GIX4|COPB_STAAR Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain MRSA252) GN=copB PE=3 SV=1 409 1048 4.0E-69
sp|Q8XD24|COPA_ECO57 Copper-exporting P-type ATPase A OS=Escherichia coli O157:H7 GN=copA PE=3 SV=3 255 1051 5.0E-69
sp|Q8Z8S4|COPA_SALTI Copper-exporting P-type ATPase A OS=Salmonella typhi GN=copA PE=3 SV=3 409 1051 6.0E-69
sp|Q59385|COPA_ECOLI Copper-exporting P-type ATPase A OS=Escherichia coli (strain K12) GN=copA PE=1 SV=4 255 1051 1.0E-68
sp|A8YZ02|COPB_STAAT Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copB PE=3 SV=1 470 1048 8.0E-68
sp|Q2FKI2|COPB_STAA3 Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300) GN=copB PE=3 SV=1 470 1048 8.0E-68
sp|Q8CQF7|COPB_STAES Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copB PE=3 SV=1 470 1048 1.0E-67
sp|Q5HKB0|COPB_STAEQ Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copB PE=3 SV=2 470 1048 2.0E-67
sp|Q8ZCA7|COPA_YERPE Copper-exporting P-type ATPase A OS=Yersinia pestis GN=copA PE=3 SV=1 441 1051 1.0E-66
sp|Q9KPZ7|COPA_VIBCH Copper-exporting P-type ATPase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=copA PE=3 SV=1 454 1052 1.0E-66
sp|Q59467|COPA2_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 453 1051 1.0E-66
sp|P37385|ATSY_SYNE7 Probable copper-transporting ATPase SynA OS=Synechococcus elongatus (strain PCC 7942) GN=synA PE=3 SV=1 425 1039 2.0E-66
sp|Q4LAB1|COPB_STAHJ Probable copper-transporting P-type ATPase B OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copB PE=3 SV=2 470 1048 4.0E-66
sp|P07893|ATSY_SYNP6 Probable copper-transporting ATPase SynA OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=synA PE=3 SV=2 425 1039 3.0E-65
sp|Q9X5V3|ATCU_RHILV Copper-transporting P-type ATPase OS=Rhizobium leguminosarum bv. viciae GN=actP PE=1 SV=1 437 1045 3.0E-65
sp|O08462|COPA3_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 453 1051 7.0E-65
sp|Q9SZC9|HMA6_ARATH Copper-transporting ATPase PAA1, chloroplastic OS=Arabidopsis thaliana GN=PAA1 PE=2 SV=1 466 1045 1.0E-64
sp|Q9ZM69|COPA_HELPJ Copper-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=copA PE=3 SV=1 453 1051 2.0E-64
sp|P77871|COPA1_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=2 453 1051 3.0E-64
sp|B9DFX7|HMA8_ARATH Copper-transporting ATPase PAA2, chloroplastic OS=Arabidopsis thaliana GN=PAA2 PE=2 SV=1 469 1018 3.0E-63
sp|P05425|COPB_ENTHA Copper-exporting P-type ATPase B OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copB PE=1 SV=2 437 1045 2.0E-62
sp|P55989|COPA_HELPY Copper-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=copA PE=3 SV=1 453 1051 5.0E-62
sp|P9WPU1|CTPA_MYCTU Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpA PE=1 SV=1 393 1019 8.0E-60
sp|P9WPU0|CTPA_MYCTO Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpA PE=3 SV=1 393 1019 8.0E-60
sp|P37386|CADA2_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 261 1012 2.0E-58
sp|Q59207|FIXI_BRADU Nitrogen fixation protein FixI OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixI PE=3 SV=1 412 1013 6.0E-57
sp|O33533|FIXI_RHILV Nitrogen fixation protein FixI OS=Rhizobium leguminosarum bv. viciae GN=fixI PE=3 SV=1 437 1013 7.0E-56
sp|P77868|Y290_HAEIN Probable cation-transporting ATPase HI_0290 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0290 PE=3 SV=1 255 1052 8.0E-56
sp|Q6GIX1|CADA_STAAR Probable cadmium-transporting ATPase OS=Staphylococcus aureus (strain MRSA252) GN=cadA PE=3 SV=1 507 1012 7.0E-55
sp|P30336|CADA_BACPE Probable cadmium-transporting ATPase OS=Bacillus pseudofirmus (strain OF4) GN=cadA PE=3 SV=2 504 1012 7.0E-54
sp|P18398|FIXI_RHIME Nitrogen fixation protein FixI OS=Rhizobium meliloti (strain 1021) GN=fixI PE=3 SV=1 437 1013 5.0E-53
sp|P46839|CTPA_MYCLE Cation-transporting P-type ATPase A OS=Mycobacterium leprae (strain TN) GN=ctpA PE=3 SV=2 437 1006 7.0E-53
sp|P20021|CADA1_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 507 1012 5.0E-52
sp|Q60048|CADA_LISMN Probable cadmium-transporting ATPase OS=Listeria monocytogenes GN=cadA PE=1 SV=1 533 1012 5.0E-49
sp|P58414|CADA_LISMO Probable cadmium-transporting ATPase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cadA PE=3 SV=1 508 1002 8.0E-47
sp|P9WPT3|CTPD_MYCTU Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpD PE=3 SV=1 503 1028 1.0E-44
sp|P9WPT2|CTPD_MYCTO Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpD PE=3 SV=1 503 1028 1.0E-44
sp|P63686|CTPD_MYCBO Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpD PE=3 SV=1 503 1028 1.0E-44
sp|O31688|ZOSA_BACSU Zinc-transporting ATPase OS=Bacillus subtilis (strain 168) GN=zosA PE=1 SV=1 533 1046 1.0E-44
sp|P46840|CTPB_MYCLE Cation-transporting P-type ATPase B OS=Mycobacterium leprae (strain TN) GN=ctpB PE=3 SV=2 503 1019 1.0E-43
sp|O32219|CADA_BACSU Cadmium, zinc and cobalt-transporting ATPase OS=Bacillus subtilis (strain 168) GN=cadA PE=1 SV=1 551 1048 1.0E-42
sp|O64474|HMA4_ARATH Putative cadmium/zinc-transporting ATPase HMA4 OS=Arabidopsis thaliana GN=HMA4 PE=1 SV=2 474 1052 2.0E-42
sp|Q9SZW4|HMA2_ARATH Cadmium/zinc-transporting ATPase HMA2 OS=Arabidopsis thaliana GN=HMA2 PE=2 SV=1 504 1051 2.0E-41
sp|Q9RQB4|HMCT_HELFE Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter felis GN=cadA PE=3 SV=1 484 1015 3.0E-41
sp|P9WPT7|CTPJ_MYCTU Probable cation-transporting P-type ATPase J OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpJ PE=2 SV=1 548 999 6.0E-41
sp|P9WPT6|CTPJ_MYCTO Probable cation-transporting P-type ATPase J OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpJ PE=3 SV=1 548 999 6.0E-41
sp|P0CW78|HMA3B_ARATH Cadmium/zinc-transporting ATPase HMA3 OS=Arabidopsis thaliana GN=HMA3 PE=1 SV=1 503 1002 8.0E-40
sp|A0R3A7|CTPD_MYCS2 Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ctpD PE=1 SV=1 534 1008 1.0E-38
sp|Q9CCL1|CTPC_MYCLE Probable cation-transporting P-type ATPase C OS=Mycobacterium leprae (strain TN) GN=ctpC PE=3 SV=1 546 976 7.0E-38
sp|Q59998|ATZN_SYNY3 Zinc-transporting ATPase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ziaA PE=1 SV=1 533 976 2.0E-37
sp|Q9ZL53|HMCT_HELPJ Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=cadA PE=3 SV=1 435 1011 3.0E-35
sp|P9WPS7|CTPG_MYCTU Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpG PE=1 SV=1 533 976 7.0E-35
sp|P9WPS6|CTPG_MYCTO Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpG PE=3 SV=1 533 976 7.0E-35
sp|P63690|CTPG_MYCBO Probable cation-transporting ATPase G OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpG PE=3 SV=1 533 976 7.0E-35
sp|Q59465|HMCT_HELPY Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=cadA PE=1 SV=2 483 1011 1.0E-34
sp|P9WPT5|CTPC_MYCTU Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpC PE=1 SV=1 558 976 1.0E-33
sp|P9WPT4|CTPC_MYCTO Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpC PE=3 SV=1 558 976 1.0E-33
sp|P0A503|CTPC_MYCBO Probable cation-transporting P-type ATPase C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpC PE=3 SV=1 558 976 1.0E-33
sp|P37617|ATZN_ECOLI Lead, cadmium, zinc and mercury-transporting ATPase OS=Escherichia coli (strain K12) GN=zntA PE=1 SV=1 507 1020 4.0E-32
sp|P0CW77|HMA3A_ARATH Putative inactive cadmium/zinc-transporting ATPase HMA3 OS=Arabidopsis thaliana GN=HMA3 PE=5 SV=1 503 866 1.0E-29
sp|Q9M3H5|HMA1_ARATH Probable cadmium/zinc-transporting ATPase HMA1, chloroplastic OS=Arabidopsis thaliana GN=HMA1 PE=2 SV=2 483 1022 5.0E-25
sp|Q926K7|KDPB2_LISIN Potassium-transporting ATPase ATP-binding subunit 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB2 PE=3 SV=1 525 976 8.0E-21
sp|Q4LAI2|KDPB_STAHJ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=kdpB PE=3 SV=1 425 976 2.0E-20
sp|C3LF99|KDPB_BACAC Potassium-transporting ATPase ATP-binding subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=kdpB PE=3 SV=1 507 976 2.0E-20
sp|P57700|KDPB_THEAC Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=kdpB PE=3 SV=1 480 964 2.0E-20
sp|B7HWG1|KDPB_BACC7 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH187) GN=kdpB PE=3 SV=1 507 976 2.0E-20
sp|Q81HQ0|KDPB_BACCR Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=kdpB PE=3 SV=1 507 976 4.0E-20
sp|Q63FR0|KDPB_BACCZ Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ZK / E33L) GN=kdpB PE=3 SV=1 507 976 4.0E-20
sp|C1EYK0|KDPB_BACC3 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain 03BB102) GN=kdpB PE=3 SV=1 507 976 4.0E-20
sp|A0RA13|KDPB_BACAH Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis (strain Al Hakam) GN=kdpB PE=3 SV=1 507 976 6.0E-20
sp|Q6HN78|KDPB_BACHK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=kdpB PE=3 SV=1 507 976 6.0E-20
sp|Q5HK64|KDPB_STAEQ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=kdpB PE=3 SV=1 446 976 6.0E-20
sp|Q6GKN3|KDPB1_STAAR Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB1 PE=3 SV=1 446 976 6.0E-20
sp|P0A008|KDPB1_STAAN Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain N315) GN=kdpB1 PE=3 SV=1 446 976 6.0E-20
sp|P0A007|KDPB1_STAAM Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB1 PE=3 SV=1 446 976 6.0E-20
sp|B7HDF9|KDPB_BACC4 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain B4264) GN=kdpB PE=3 SV=1 507 976 1.0E-19
sp|Q8YSD5|KDPB2_NOSS1 Potassium-transporting ATPase ATP-binding subunit 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB2 PE=3 SV=1 510 976 1.0E-19
sp|Q9R6X1|KDPB_ANASL Potassium-transporting ATPase ATP-binding subunit OS=Anabaena sp. (strain L31) GN=kdpB PE=3 SV=1 533 976 1.0E-19
sp|B7JRB8|KDPB_BACC0 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH820) GN=kdpB PE=3 SV=1 507 976 1.0E-19
sp|B7II09|KDPB_BACC2 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain G9842) GN=kdpB PE=3 SV=1 507 976 2.0E-19
sp|Q8YPE9|KDPB1_NOSS1 Potassium-transporting ATPase ATP-binding subunit 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB1 PE=3 SV=1 547 976 2.0E-19
sp|A9VFM1|KDPB_BACWK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=kdpB PE=3 SV=1 507 976 4.0E-19
sp|Q9RZP0|KDPB_DEIRA Potassium-transporting ATPase ATP-binding subunit OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=kdpB PE=3 SV=1 522 976 1.0E-18
sp|Q92XJ0|KDPB_RHIME Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium meliloti (strain 1021) GN=kdpB PE=3 SV=1 535 976 1.0E-18
sp|C4LDL7|KDPB_TOLAT Potassium-transporting ATPase ATP-binding subunit OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=kdpB PE=3 SV=1 506 976 4.0E-18
sp|Q57RN0|KDPB_SALCH Potassium-transporting ATPase ATP-binding subunit OS=Salmonella choleraesuis (strain SC-B67) GN=kdpB PE=3 SV=1 558 976 5.0E-18
sp|P35597|EXP7_STRPN Probable cation-transporting ATPase exp7 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp7 PE=3 SV=2 534 1046 5.0E-18
sp|Q6GEZ7|KDPB2_STAAR Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB2 PE=3 SV=1 522 976 6.0E-18
sp|A4W860|KDPB_ENT38 Potassium-transporting ATPase ATP-binding subunit OS=Enterobacter sp. (strain 638) GN=kdpB PE=3 SV=1 558 976 6.0E-18
sp|O32328|KDPB_CLOAB Potassium-transporting ATPase ATP-binding subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=kdpB PE=3 SV=2 509 976 6.0E-18
sp|P73867|KDPB_SYNY3 Potassium-transporting ATPase ATP-binding subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=kdpB PE=3 SV=1 500 976 6.0E-18
sp|P57698|KDPB_PSEAE Potassium-transporting ATPase ATP-binding subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=kdpB PE=3 SV=1 547 976 7.0E-18
sp|B2TMJ2|KDPB_CLOBB Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=kdpB PE=3 SV=1 469 964 1.0E-17
sp|Q8NVI2|KDPB_STAAW Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MW2) GN=kdpB PE=3 SV=1 522 976 2.0E-17
sp|Q6G7N3|KDPB_STAAS Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MSSA476) GN=kdpB PE=3 SV=1 522 976 2.0E-17
sp|B1IY32|KDPB_ECOLC Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=kdpB PE=3 SV=1 489 976 2.0E-17
sp|P63684|KDPB2_STAAN Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain N315) GN=kdpB2 PE=3 SV=1 522 976 2.0E-17
sp|P63683|KDPB2_STAAM Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB2 PE=3 SV=1 522 976 2.0E-17
sp|A8Z4X9|KDPB_STAAT Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=kdpB PE=3 SV=1 522 976 2.0E-17
sp|A6QIS1|KDPB_STAAE Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain Newman) GN=kdpB PE=3 SV=1 522 976 2.0E-17
sp|Q5HEC4|KDPB_STAAC Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain COL) GN=kdpB PE=3 SV=1 522 976 2.0E-17
sp|Q2YUH7|KDPB_STAAB Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=kdpB PE=3 SV=1 522 976 3.0E-17
sp|B4U8E4|KDPB_HYDS0 Potassium-transporting ATPase ATP-binding subunit OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=kdpB PE=3 SV=1 485 977 3.0E-17
sp|P57699|KDPB_HALSA Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=kdpB PE=3 SV=1 500 964 3.0E-17
sp|B0R9M0|KDPB_HALS3 Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=kdpB PE=2 SV=1 500 964 3.0E-17
sp|A7GLG4|KDPB_BACCN Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=kdpB PE=3 SV=1 503 976 3.0E-17
sp|P03960|KDPB_ECOLI Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12) GN=kdpB PE=1 SV=3 489 976 3.0E-17
sp|B1X6M8|KDPB_ECODH Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / DH10B) GN=kdpB PE=3 SV=1 489 976 3.0E-17
sp|C4ZWH3|KDPB_ECOBW Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=kdpB PE=3 SV=1 489 976 3.0E-17
sp|B6HYQ5|KDPB_ECOSE Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SE11) GN=kdpB PE=3 SV=1 489 976 5.0E-17
sp|A7ZJ80|KDPB_ECO24 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=kdpB PE=3 SV=1 489 976 5.0E-17
sp|B7M5L3|KDPB_ECO8A Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O8 (strain IAI1) GN=kdpB PE=3 SV=1 489 976 7.0E-17
sp|B7LAA4|KDPB_ECO55 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain 55989 / EAEC) GN=kdpB PE=3 SV=1 489 976 7.0E-17
sp|Q47H39|KDPB_DECAR Potassium-transporting ATPase ATP-binding subunit OS=Dechloromonas aromatica (strain RCB) GN=kdpB PE=3 SV=1 514 964 1.0E-16
sp|Q0TRT3|KDPB_CLOP1 Potassium-transporting ATPase ATP-binding subunit OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=kdpB PE=3 SV=1 468 964 1.0E-16
sp|B1LLE1|KDPB_ECOSM Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=kdpB PE=3 SV=1 489 976 1.0E-16
sp|B2V2P3|KDPB_CLOBA Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=kdpB PE=3 SV=1 469 964 1.0E-16
sp|A7ZXV8|KDPB_ECOHS Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O9:H4 (strain HS) GN=kdpB PE=3 SV=1 489 976 2.0E-16
sp|B7NMQ0|KDPB_ECO7I Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=kdpB PE=3 SV=1 489 976 2.0E-16
sp|Q3Z4A6|KDPB_SHISS Potassium-transporting ATPase ATP-binding subunit OS=Shigella sonnei (strain Ss046) GN=kdpB PE=3 SV=1 489 976 2.0E-16
sp|Q324L0|KDPB_SHIBS Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=kdpB PE=3 SV=1 489 976 3.0E-16
sp|B5YQN9|KDPB_ECO5E Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=kdpB PE=3 SV=1 489 976 3.0E-16
sp|Q8X9F9|KDPB_ECO57 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 GN=kdpB PE=3 SV=1 489 976 3.0E-16
sp|Q8R8I6|KDPB_CALS4 Potassium-transporting ATPase ATP-binding subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=kdpB PE=3 SV=1 510 976 3.0E-16
sp|B5R670|KDPB_SALG2 Potassium-transporting ATPase ATP-binding subunit OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=kdpB PE=3 SV=1 558 976 4.0E-16
sp|B4SZB1|KDPB_SALNS Potassium-transporting ATPase ATP-binding subunit OS=Salmonella newport (strain SL254) GN=kdpB PE=3 SV=1 558 976 4.0E-16
sp|B4TQ22|KDPB_SALSV Potassium-transporting ATPase ATP-binding subunit OS=Salmonella schwarzengrund (strain CVM19633) GN=kdpB PE=3 SV=1 558 976 4.0E-16
sp|B2TTJ7|KDPB_SHIB3 Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=kdpB PE=3 SV=1 489 976 4.0E-16
sp|Q927G0|KDPB1_LISIN Potassium-transporting ATPase ATP-binding subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB1 PE=3 SV=1 482 964 4.0E-16
sp|Q8KU73|KDPB_ENTFA Potassium-transporting ATPase ATP-binding subunit OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=kdpB PE=3 SV=1 552 964 4.0E-16
sp|Q8ZQW2|KDPB_SALTY Potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=kdpB PE=3 SV=1 558 976 5.0E-16
sp|B4TBA6|KDPB_SALHS Potassium-transporting ATPase ATP-binding subunit OS=Salmonella heidelberg (strain SL476) GN=kdpB PE=3 SV=1 558 976 5.0E-16
sp|B5QWE9|KDPB_SALEP Potassium-transporting ATPase ATP-binding subunit OS=Salmonella enteritidis PT4 (strain P125109) GN=kdpB PE=3 SV=1 558 976 5.0E-16
sp|A9MUE0|KDPB_SALPB Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=kdpB PE=3 SV=1 558 976 5.0E-16
sp|B5BCA4|KDPB_SALPK Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain AKU_12601) GN=kdpB PE=3 SV=1 558 976 5.0E-16
sp|Q5PCJ7|KDPB_SALPA Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=kdpB PE=3 SV=1 558 976 5.0E-16
sp|B8DAW1|KDPB_LISMH Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=kdpB PE=3 SV=1 482 964 5.0E-16
sp|Q1REM0|KDPB_ECOUT Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain UTI89 / UPEC) GN=kdpB PE=3 SV=1 489 976 6.0E-16
sp|A1A8W1|KDPB_ECOK1 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O1:K1 / APEC GN=kdpB PE=3 SV=1 489 976 6.0E-16
sp|B7MFW2|KDPB_ECO45 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=kdpB PE=3 SV=1 489 976 6.0E-16
sp|B5FNE0|KDPB_SALDC Potassium-transporting ATPase ATP-binding subunit OS=Salmonella dublin (strain CT_02021853) GN=kdpB PE=3 SV=1 558 976 6.0E-16
sp|B7LKR7|KDPB_ESCF3 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=kdpB PE=3 SV=1 489 976 6.0E-16
sp|Q97BF6|KDPB_THEVO Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=kdpB PE=3 SV=1 536 964 9.0E-16
sp|Q8U9D9|KDPB_AGRFC Potassium-transporting ATPase ATP-binding subunit OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=kdpB PE=3 SV=2 504 976 9.0E-16
sp|B7MPK0|KDPB_ECO81 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O81 (strain ED1a) GN=kdpB PE=3 SV=1 489 976 1.0E-15
sp|Q8FJV4|KDPB_ECOL6 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=kdpB PE=3 SV=1 489 976 1.0E-15
sp|Q0TJY9|KDPB_ECOL5 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=kdpB PE=3 SV=1 489 976 1.0E-15
sp|B7UKX6|KDPB_ECO27 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=kdpB PE=3 SV=1 489 976 1.0E-15
sp|B5EZE3|KDPB_SALA4 Potassium-transporting ATPase ATP-binding subunit OS=Salmonella agona (strain SL483) GN=kdpB PE=3 SV=1 558 976 1.0E-15
sp|Q71W90|KDPB_LISMF Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=kdpB PE=3 SV=1 482 964 1.0E-15
sp|C1KZN5|KDPB_LISMC Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=kdpB PE=3 SV=1 482 964 1.0E-15
sp|A4SZG8|KDPB_POLSQ Potassium-transporting ATPase ATP-binding subunit OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=kdpB PE=3 SV=1 514 976 2.0E-15
sp|Q8Y3Z7|KDPB_LISMO Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=kdpB PE=3 SV=1 482 964 2.0E-15
sp|Q9X8Z9|KDPB_STRCO Potassium-transporting ATPase ATP-binding subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=kdpB PE=3 SV=3 504 964 2.0E-15
sp|B7N9U0|KDPB_ECOLU Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=kdpB PE=3 SV=1 558 976 3.0E-15
sp|P59219|KDPB_LEPIN Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=kdpB PE=3 SV=2 553 976 3.0E-15
sp|Q93MV5|KDPB_MYXXA Potassium-transporting ATPase ATP-binding subunit OS=Myxococcus xanthus GN=kdpB PE=3 SV=1 546 964 4.0E-15
sp|A6T6D8|KDPB_KLEP7 Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=kdpB PE=3 SV=1 489 976 7.0E-15
sp|A0AM16|KDPB_LISW6 Potassium-transporting ATPase ATP-binding subunit OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=kdpB PE=3 SV=1 482 964 8.0E-15
sp|Q8XU11|KDPB_RALSO Potassium-transporting ATPase ATP-binding subunit OS=Ralstonia solanacearum (strain GMI1000) GN=kdpB PE=3 SV=1 531 976 1.0E-14
sp|B5XZE9|KDPB_KLEP3 Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae (strain 342) GN=kdpB PE=3 SV=1 489 976 2.0E-14
sp|A1JQS2|KDPB_YERE8 Potassium-transporting ATPase ATP-binding subunit OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=kdpB PE=3 SV=1 547 976 4.0E-14
sp|Q58623|Y1226_METJA Putative cation-transporting ATPase MJ1226 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1226 PE=3 SV=1 508 958 4.0E-14
sp|A8GB61|KDPB_SERP5 Potassium-transporting ATPase ATP-binding subunit OS=Serratia proteamaculans (strain 568) GN=kdpB PE=3 SV=1 546 976 4.0E-14
sp|Q72TM6|KDPB_LEPIC Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=kdpB PE=3 SV=1 553 976 4.0E-14
sp|Q43128|PMA10_ARATH ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=AHA10 PE=2 SV=2 541 998 7.0E-14
sp|A4TL06|KDPB_YERPP Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis (strain Pestoides F) GN=kdpB PE=3 SV=1 517 976 7.0E-14
sp|Q1CKH2|KDPB_YERPN Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=kdpB PE=3 SV=1 517 976 7.0E-14
sp|A9R3X3|KDPB_YERPG Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Angola) GN=kdpB PE=3 SV=1 517 976 7.0E-14
sp|Q8ZD97|KDPB_YERPE Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis GN=kdpB PE=3 SV=1 517 976 7.0E-14
sp|B2KA78|KDPB_YERPB Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=kdpB PE=3 SV=1 517 976 7.0E-14
sp|Q1C586|KDPB_YERPA Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=kdpB PE=3 SV=1 517 976 7.0E-14
sp|Q667S4|KDPB_YERPS Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=kdpB PE=3 SV=1 517 976 7.0E-14
sp|B1JR96|KDPB_YERPY Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=kdpB PE=3 SV=1 517 976 8.0E-14
sp|A7FFQ9|KDPB_YERP3 Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=kdpB PE=3 SV=1 517 976 8.0E-14
sp|Q9SH76|PMA6_ARATH ATPase 6, plasma membrane-type OS=Arabidopsis thaliana GN=AHA6 PE=2 SV=1 541 1012 8.0E-14
sp|P9WPU3|KDPB_MYCTU Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdpB PE=3 SV=1 553 976 1.0E-13
sp|P9WPU2|KDPB_MYCTO Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdpB PE=3 SV=1 553 976 1.0E-13
sp|P63682|KDPB_MYCBO Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kdpB PE=3 SV=1 553 976 1.0E-13
sp|Q8PCM1|KDPB_XANCP Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=kdpB PE=3 SV=1 506 976 1.0E-13
sp|Q9A7X7|KDPB_CAUCR Potassium-transporting ATPase ATP-binding subunit OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=kdpB PE=3 SV=1 530 976 2.0E-13
sp|Q7N6W6|KDPB_PHOLL Potassium-transporting ATPase ATP-binding subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=kdpB PE=3 SV=1 546 976 2.0E-13
sp|Q98GX6|KDPB_RHILO Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium loti (strain MAFF303099) GN=kdpB PE=3 SV=1 514 976 2.0E-13
sp|B2VJK3|KDPB_ERWT9 Potassium-transporting ATPase ATP-binding subunit OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=kdpB PE=3 SV=1 558 976 2.0E-13
sp|Q03194|PMA4_NICPL Plasma membrane ATPase 4 OS=Nicotiana plumbaginifolia GN=PMA4 PE=2 SV=1 541 974 4.0E-13
sp|P11718|ATXA_LEIDO Probable proton ATPase 1A OS=Leishmania donovani GN=H1A PE=2 SV=2 509 786 8.0E-13
sp|P12522|ATXB_LEIDO Probable proton ATPase 1B OS=Leishmania donovani GN=H1B PE=2 SV=1 520 786 3.0E-12
sp|Q9LY32|PMA7_ARATH ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=AHA7 PE=2 SV=1 541 1024 4.0E-12
sp|Q7XPY2|PMA1_ORYSJ Plasma membrane ATPase OS=Oryza sativa subsp. japonica GN=Os04g0656100 PE=2 SV=1 541 974 4.0E-12
sp|Q8PPC9|KDPB_XANAC Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas axonopodis pv. citri (strain 306) GN=kdpB PE=3 SV=1 506 976 6.0E-12
sp|P83970|PMA1_WHEAT Plasma membrane ATPase OS=Triticum aestivum GN=ha1 PE=2 SV=1 541 974 1.0E-11
sp|Q9SU58|PMA4_ARATH ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=AHA4 PE=2 SV=2 541 1012 1.0E-11
sp|Q42556|PMA9_ARATH ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=AHA9 PE=2 SV=2 541 995 2.0E-11
sp|P9WPT0|CTPE_MYCTO Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpE PE=3 SV=1 584 1012 4.0E-11
sp|P9WPT1|CTPE_MYCTU Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpE PE=1 SV=1 584 1012 4.0E-11
sp|P0A505|CTPE_MYCBO Probable cation-transporting ATPase E OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpE PE=3 SV=1 584 1012 4.0E-11
sp|P19456|PMA2_ARATH ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=AHA2 PE=1 SV=2 541 974 1.0E-10
sp|Q9M2A0|PMA8_ARATH ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=AHA8 PE=3 SV=1 541 1012 2.0E-10
sp|Q08436|PMA3_NICPL Plasma membrane ATPase 3 OS=Nicotiana plumbaginifolia GN=PMA3 PE=1 SV=1 541 1012 4.0E-10
sp|P20431|PMA3_ARATH ATPase 3, plasma membrane-type OS=Arabidopsis thaliana GN=AHA3 PE=1 SV=2 541 974 5.0E-10
sp|P20649|PMA1_ARATH ATPase 1, plasma membrane-type OS=Arabidopsis thaliana GN=AHA1 PE=1 SV=3 541 998 6.0E-10
sp|P07038|PMA1_NEUCR Plasma membrane ATPase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pma-1 PE=1 SV=1 513 784 7.0E-10
sp|Q9LV11|PMA11_ARATH ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=AHA11 PE=1 SV=1 541 1012 9.0E-10
sp|Q08435|PMA1_NICPL Plasma membrane ATPase 1 OS=Nicotiana plumbaginifolia GN=PMA1 PE=2 SV=1 541 974 1.0E-09
sp|P22180|PMA1_SOLLC Plasma membrane ATPase 1 OS=Solanum lycopersicum GN=LHA1 PE=2 SV=1 541 974 2.0E-09
sp|P54211|PMA1_DUNBI Plasma membrane ATPase OS=Dunaliella bioculata GN=PMA1 PE=2 SV=1 509 1011 5.0E-09
sp|Q9SJB3|PMA5_ARATH ATPase 5, plasma membrane-type OS=Arabidopsis thaliana GN=AHA5 PE=3 SV=3 541 974 7.0E-09
sp|Q9CFU9|LLCA1_LACLA Calcium-transporting ATPase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yoaB PE=1 SV=1 504 778 1.0E-08
sp|Q8Y8Q5|LMCA1_LISMO Calcium-transporting ATPase lmo0841 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0841 PE=1 SV=1 508 771 6.0E-08
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 456 771 1.0E-07
sp|P09627|PMA1_SCHPO Plasma membrane ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma1 PE=1 SV=1 513 995 1.0E-07
sp|Q8Z8E5|KDPB_SALTI Putative potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhi GN=kdpB PE=5 SV=1 729 976 3.0E-07
sp|Q73E41|BACA1_BACC1 Calcium-transporting ATPase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0519 PE=1 SV=1 482 768 3.0E-07
sp|P24545|PMA1_ZYGRO Plasma membrane ATPase OS=Zygosaccharomyces rouxii PE=3 SV=1 534 995 4.0E-07
sp|Q5R5K5|AT2C1_PONAB Calcium-transporting ATPase type 2C member 1 OS=Pongo abelii GN=ATP2C1 PE=2 SV=1 834 976 1.0E-06
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 553 760 2.0E-06
sp|Q9T0E0|PMAX_ARATH Putative ATPase, plasma membrane-like OS=Arabidopsis thaliana GN=At4g11730 PE=3 SV=1 510 778 2.0E-06
sp|P54210|PMA1_DUNAC Plasma membrane ATPase OS=Dunaliella acidophila GN=DHA1 PE=2 SV=1 509 974 2.0E-06
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 553 760 2.0E-06
sp|P57709|AT2C1_BOVIN Calcium-transporting ATPase type 2C member 1 OS=Bos taurus GN=ATP2C1 PE=2 SV=1 834 976 2.0E-06
sp|P98194|AT2C1_HUMAN Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens GN=ATP2C1 PE=1 SV=3 834 976 2.0E-06
sp|P28877|PMA1_CANAX Plasma membrane ATPase 1 OS=Candida albicans GN=PMA1 PE=1 SV=1 513 759 2.0E-06
sp|O75185|AT2C2_HUMAN Calcium-transporting ATPase type 2C member 2 OS=Homo sapiens GN=ATP2C2 PE=1 SV=2 840 976 3.0E-06
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 471 599 3.0E-06
sp|O53114|CTPI_MYCLE Probable cation-transporting ATPase I OS=Mycobacterium leprae (strain TN) GN=ctpI PE=3 SV=1 553 760 3.0E-06
sp|Q73E41|BACA1_BACC1 Calcium-transporting ATPase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0519 PE=1 SV=1 860 974 4.0E-06
sp|P9WPS9|CTPF_MYCTU Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpF PE=1 SV=1 504 759 4.0E-06
sp|P9WPS8|CTPF_MYCTO Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpF PE=2 SV=1 504 759 4.0E-06
sp|P63688|CTPF_MYCBO Probable cation-transporting ATPase F OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpF PE=3 SV=1 504 759 4.0E-06
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 456 771 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0030001 metal ion transport Yes
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 410 429 19
2 436 458 22
3 473 495 22
4 502 524 22
5 653 675 22
6 696 718 22
7 996 1018 22
8 1025 1047 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11034
MGAGNCCSSGASQDAASRPDVNGHDHVNGHDHAHDGCASSQQNPCSEQGECCDDDSCCDDSPPSCSATLVCCDSY
EERCDEKCILVAAALECEKTCENDAFGQDGTPTHEHAHDEDGKHPTSACSTHLAKAFDQYSAYLESARCICRSIL
DRGWSTTCCAEQPKQAAATGKATVDTKRSAFTSSHGLHGHEGPHHHHGVKRRGRKTRRQHDDALVMLQEVDSCCG
GHDAHQHDHAAVETDGNIKSWDLEKAQGLEHVALSVDGMTCSGCGNKMERALRTAPGVSSARVNFVMGSAEFSLD
TSIASPDDVVRAAEKATGFRCTKLFSDDQTIDVLASGHSAMALTDALIPGVTQAAVLDKKVVRITYDPVLIGART
LMEKVGPLSNGLAPPGDDPSVSGGRKILHDKLMKTVIAACFTIPVLVLAWSDHLVDDRTEAYVSIVLATVVQLIA
VPDFYQPAISALVHSGTVEMDMLVVISITAAYVYSVVAFSFAMAGKPLETKAFFETSTLLITLVLLGRLIAAFAR
VRAVAAVSLRSLQSAKAVIIEDGADREVDSRLLQYGDKLRVGPHAAVPTDATVIGGSSEVDESMITGESIPVVKK
EGDALIAGTINGSGSLAALLTRLPGKNTVTDIARLVEEAASSKPRLQDIADRVAGWFVPFVTAAALVVVVVWIVV
GLEVRGYGAGKAISNATTFAVATLAVSCPCAIGLAVPMVLVVAGGIAARNGVIIKSAECTERARKVTDVVFDKTG
TITEPDLEVVDEQFFADNQKEAVAVCKALVAGNKHPVSLAVARHLEQRGCSEVRLTDVRVIPGAGVDASLNGTAI
RAGNPTWTKTSSHPAVSRLQEHGVTLLVVTRGAELIALFAMRTRLRAEAIGVVAKLGRRNVAVHLVSGDQKGAVD
AVAANVGILHVASQCTPSQKRDYVAGLMARGRTVMFVGDGTNDAVAVTQADVGVQLANVQSASEVTRSAADVVLL
NGLEGIPFILRISAVSFRRIAFNFAWSAIYNLLAILLASGAFVKVRIPPAYAGLGEIVSVLPVVLAAMTMLLKKI
KLAEA*
Coding >Hirsu2|11034
ATGGGTGCCGGAAACTGCTGCTCGAGTGGCGCAAGCCAGGACGCTGCGTCTCGTCCTGACGTCAACGGCCACGAC
CACGTCAACGGCCACGACCACGCCCATGACGGTTGCGCCTCTTCTCAGCAGAACCCCTGCTCTGAGCAGGGCGAG
TGCTGCGACGACGACAGCTGCTGCGACGACTCGCCGCCCAGCTGCTCCGCCACTCTCGTCTGCTGCGACTCCTAT
GAGGAGCGTTGCGATGAGAAATGCATCCTCGTCGCCGCCGCCCTCGAGTGCGAGAAGACGTGCGAGAACGATGCC
TTTGGCCAAGATGGCACGCCCACTCACGAGCATGCCCACGACGAAGACGGCAAACATCCGACCTCGGCCTGCAGC
ACCCATCTGGCCAAGGCTTTCGACCAGTACAGCGCCTACCTCGAGTCCGCGCGCTGCATCTGCCGCAGCATCCTC
GACCGAGGCTGGTCGACCACCTGTTGCGCCGAGCAGCCGAAGCAGGCGGCGGCCACCGGCAAGGCCACCGTCGAC
ACGAAACGAAGCGCCTTCACCAGCAGCCACGGATTGCACGGCCACGAGGGGCCCCATCACCATCATGGCGTGAAG
CGCCGAGGCAGGAAGACGCGCCGCCAGCACGACGACGCCCTCGTCATGCTCCAAGAGGTAGACAGCTGCTGCGGG
GGCCACGATGCCCACCAGCACGACCACGCGGCCGTCGAGACGGACGGCAACATCAAAAGTTGGGATCTTGAAAAG
GCTCAGGGGCTCGAGCACGTTGCGCTCTCGGTCGACGGCATGACCTGTTCTGGATGCGGCAACAAGATGGAGCGT
GCCCTCCGGACCGCCCCGGGCGTCTCTTCGGCGCGAGTCAACTTCGTCATGGGGTCGGCCGAGTTCAGCCTCGAC
ACCTCCATCGCCTCCCCGGACGATGTCGTTCGCGCGGCCGAGAAAGCCACGGGATTTCGCTGCACCAAACTGTTC
AGCGACGACCAGACAATCGACGTGCTGGCCAGTGGCCACTCGGCCATGGCGCTTACCGACGCCCTGATCCCTGGC
GTCACCCAGGCCGCGGTCCTCGACAAGAAAGTCGTCCGCATCACCTACGACCCGGTGCTCATCGGAGCCAGGACT
TTGATGGAGAAGGTCGGGCCACTGTCGAATGGGCTGGCGCCCCCAGGCGATGACCCAAGCGTGTCCGGCGGTCGC
AAGATTCTCCACGACAAGCTCATGAAGACGGTGATCGCTGCTTGCTTCACCATACCAGTCCTGGTCCTGGCGTGG
TCCGACCACCTCGTAGACGACAGGACCGAAGCCTACGTCTCCATCGTTCTCGCCACCGTGGTGCAACTGATCGCG
GTGCCCGACTTTTATCAGCCGGCCATATCCGCCCTCGTCCACAGCGGTACCGTCGAGATGGACATGTTGGTGGTC
ATCAGCATCACGGCTGCGTACGTCTACTCGGTCGTCGCATTTAGCTTCGCCATGGCCGGCAAGCCGCTCGAGACC
AAGGCCTTCTTCGAGACGAGCACATTGCTCATAACGCTCGTTCTGCTTGGCCGTCTCATCGCCGCCTTCGCCCGC
GTCAGGGCCGTGGCTGCGGTTTCGCTTCGATCTCTCCAATCGGCCAAGGCTGTCATCATTGAAGATGGCGCGGAC
CGCGAGGTCGACTCCCGTCTGCTACAATATGGTGACAAGCTGAGAGTAGGCCCCCATGCAGCTGTCCCTACCGAC
GCCACCGTGATTGGTGGCTCGAGCGAGGTGGACGAGTCCATGATCACGGGTGAGAGCATCCCCGTGGTGAAAAAG
GAGGGGGACGCCCTCATCGCAGGCACCATCAACGGCTCGGGCTCCCTGGCGGCGCTGCTGACGCGCCTCCCCGGC
AAGAACACCGTGACGGACATCGCTCGGCTGGTAGAGGAGGCTGCCAGCTCAAAGCCCAGACTCCAGGACATTGCC
GACCGCGTCGCTGGGTGGTTTGTTCCCTTCGTCACAGCCGCGGCCCTCGTCGTCGTCGTCGTCTGGATTGTCGTC
GGCCTCGAAGTACGCGGCTACGGCGCAGGCAAAGCTATATCCAACGCCACCACCTTCGCTGTCGCGACCCTGGCC
GTGTCATGCCCCTGCGCAATCGGCCTCGCCGTTCCCATGGTCCTTGTTGTGGCCGGCGGTATTGCCGCCCGCAAT
GGCGTTATCATCAAGTCGGCCGAATGCACTGAGCGCGCTCGCAAGGTGACCGATGTCGTCTTCGACAAGACGGGG
ACCATCACCGAGCCTGACCTCGAGGTTGTGGACGAGCAGTTCTTCGCCGACAACCAGAAGGAGGCTGTTGCGGTC
TGCAAGGCACTTGTCGCTGGGAACAAGCACCCAGTGTCGCTTGCCGTCGCCCGGCATCTCGAACAGCGTGGCTGC
TCCGAGGTCAGGCTGACCGACGTGCGTGTCATCCCTGGTGCGGGCGTCGATGCCAGCTTGAACGGCACGGCGATC
CGTGCTGGAAATCCAACTTGGACCAAGACGTCAAGTCATCCGGCCGTTTCCCGGCTGCAGGAGCATGGTGTCACG
CTCCTTGTCGTGACGCGCGGCGCTGAGCTCATTGCCCTATTCGCGATGCGCACTCGCCTTCGCGCCGAGGCGATC
GGCGTCGTCGCCAAGCTCGGGCGCCGCAACGTCGCCGTCCACCTTGTTTCCGGCGACCAGAAGGGCGCCGTCGAT
GCCGTGGCTGCCAACGTTGGCATTTTGCATGTCGCCTCGCAGTGTACGCCTTCGCAGAAACGCGATTATGTCGCG
GGCCTCATGGCTCGTGGCAGGACCGTCATGTTCGTCGGCGATGGTACCAATGACGCCGTCGCCGTAACACAGGCA
GACGTGGGCGTCCAGCTCGCCAATGTTCAGTCCGCCAGCGAAGTCACCCGAAGCGCCGCCGACGTAGTGCTTCTC
AATGGCCTCGAGGGAATCCCCTTCATTCTGCGCATCAGCGCCGTCAGCTTCCGCCGCATTGCCTTCAACTTTGCC
TGGTCTGCCATCTACAACCTGCTGGCCATTCTTCTCGCCTCGGGTGCCTTTGTGAAAGTGCGTATCCCTCCCGCA
TACGCAGGCCTCGGCGAGATCGTCAGCGTCCTGCCTGTTGTTTTAGCGGCTATGACAATGCTTCTGAAAAAGATC
AAACTAGCGGAAGCCTGA
Transcript >Hirsu2|11034
ATGGGTGCCGGAAACTGCTGCTCGAGTGGCGCAAGCCAGGACGCTGCGTCTCGTCCTGACGTCAACGGCCACGAC
CACGTCAACGGCCACGACCACGCCCATGACGGTTGCGCCTCTTCTCAGCAGAACCCCTGCTCTGAGCAGGGCGAG
TGCTGCGACGACGACAGCTGCTGCGACGACTCGCCGCCCAGCTGCTCCGCCACTCTCGTCTGCTGCGACTCCTAT
GAGGAGCGTTGCGATGAGAAATGCATCCTCGTCGCCGCCGCCCTCGAGTGCGAGAAGACGTGCGAGAACGATGCC
TTTGGCCAAGATGGCACGCCCACTCACGAGCATGCCCACGACGAAGACGGCAAACATCCGACCTCGGCCTGCAGC
ACCCATCTGGCCAAGGCTTTCGACCAGTACAGCGCCTACCTCGAGTCCGCGCGCTGCATCTGCCGCAGCATCCTC
GACCGAGGCTGGTCGACCACCTGTTGCGCCGAGCAGCCGAAGCAGGCGGCGGCCACCGGCAAGGCCACCGTCGAC
ACGAAACGAAGCGCCTTCACCAGCAGCCACGGATTGCACGGCCACGAGGGGCCCCATCACCATCATGGCGTGAAG
CGCCGAGGCAGGAAGACGCGCCGCCAGCACGACGACGCCCTCGTCATGCTCCAAGAGGTAGACAGCTGCTGCGGG
GGCCACGATGCCCACCAGCACGACCACGCGGCCGTCGAGACGGACGGCAACATCAAAAGTTGGGATCTTGAAAAG
GCTCAGGGGCTCGAGCACGTTGCGCTCTCGGTCGACGGCATGACCTGTTCTGGATGCGGCAACAAGATGGAGCGT
GCCCTCCGGACCGCCCCGGGCGTCTCTTCGGCGCGAGTCAACTTCGTCATGGGGTCGGCCGAGTTCAGCCTCGAC
ACCTCCATCGCCTCCCCGGACGATGTCGTTCGCGCGGCCGAGAAAGCCACGGGATTTCGCTGCACCAAACTGTTC
AGCGACGACCAGACAATCGACGTGCTGGCCAGTGGCCACTCGGCCATGGCGCTTACCGACGCCCTGATCCCTGGC
GTCACCCAGGCCGCGGTCCTCGACAAGAAAGTCGTCCGCATCACCTACGACCCGGTGCTCATCGGAGCCAGGACT
TTGATGGAGAAGGTCGGGCCACTGTCGAATGGGCTGGCGCCCCCAGGCGATGACCCAAGCGTGTCCGGCGGTCGC
AAGATTCTCCACGACAAGCTCATGAAGACGGTGATCGCTGCTTGCTTCACCATACCAGTCCTGGTCCTGGCGTGG
TCCGACCACCTCGTAGACGACAGGACCGAAGCCTACGTCTCCATCGTTCTCGCCACCGTGGTGCAACTGATCGCG
GTGCCCGACTTTTATCAGCCGGCCATATCCGCCCTCGTCCACAGCGGTACCGTCGAGATGGACATGTTGGTGGTC
ATCAGCATCACGGCTGCGTACGTCTACTCGGTCGTCGCATTTAGCTTCGCCATGGCCGGCAAGCCGCTCGAGACC
AAGGCCTTCTTCGAGACGAGCACATTGCTCATAACGCTCGTTCTGCTTGGCCGTCTCATCGCCGCCTTCGCCCGC
GTCAGGGCCGTGGCTGCGGTTTCGCTTCGATCTCTCCAATCGGCCAAGGCTGTCATCATTGAAGATGGCGCGGAC
CGCGAGGTCGACTCCCGTCTGCTACAATATGGTGACAAGCTGAGAGTAGGCCCCCATGCAGCTGTCCCTACCGAC
GCCACCGTGATTGGTGGCTCGAGCGAGGTGGACGAGTCCATGATCACGGGTGAGAGCATCCCCGTGGTGAAAAAG
GAGGGGGACGCCCTCATCGCAGGCACCATCAACGGCTCGGGCTCCCTGGCGGCGCTGCTGACGCGCCTCCCCGGC
AAGAACACCGTGACGGACATCGCTCGGCTGGTAGAGGAGGCTGCCAGCTCAAAGCCCAGACTCCAGGACATTGCC
GACCGCGTCGCTGGGTGGTTTGTTCCCTTCGTCACAGCCGCGGCCCTCGTCGTCGTCGTCGTCTGGATTGTCGTC
GGCCTCGAAGTACGCGGCTACGGCGCAGGCAAAGCTATATCCAACGCCACCACCTTCGCTGTCGCGACCCTGGCC
GTGTCATGCCCCTGCGCAATCGGCCTCGCCGTTCCCATGGTCCTTGTTGTGGCCGGCGGTATTGCCGCCCGCAAT
GGCGTTATCATCAAGTCGGCCGAATGCACTGAGCGCGCTCGCAAGGTGACCGATGTCGTCTTCGACAAGACGGGG
ACCATCACCGAGCCTGACCTCGAGGTTGTGGACGAGCAGTTCTTCGCCGACAACCAGAAGGAGGCTGTTGCGGTC
TGCAAGGCACTTGTCGCTGGGAACAAGCACCCAGTGTCGCTTGCCGTCGCCCGGCATCTCGAACAGCGTGGCTGC
TCCGAGGTCAGGCTGACCGACGTGCGTGTCATCCCTGGTGCGGGCGTCGATGCCAGCTTGAACGGCACGGCGATC
CGTGCTGGAAATCCAACTTGGACCAAGACGTCAAGTCATCCGGCCGTTTCCCGGCTGCAGGAGCATGGTGTCACG
CTCCTTGTCGTGACGCGCGGCGCTGAGCTCATTGCCCTATTCGCGATGCGCACTCGCCTTCGCGCCGAGGCGATC
GGCGTCGTCGCCAAGCTCGGGCGCCGCAACGTCGCCGTCCACCTTGTTTCCGGCGACCAGAAGGGCGCCGTCGAT
GCCGTGGCTGCCAACGTTGGCATTTTGCATGTCGCCTCGCAGTGTACGCCTTCGCAGAAACGCGATTATGTCGCG
GGCCTCATGGCTCGTGGCAGGACCGTCATGTTCGTCGGCGATGGTACCAATGACGCCGTCGCCGTAACACAGGCA
GACGTGGGCGTCCAGCTCGCCAATGTTCAGTCCGCCAGCGAAGTCACCCGAAGCGCCGCCGACGTAGTGCTTCTC
AATGGCCTCGAGGGAATCCCCTTCATTCTGCGCATCAGCGCCGTCAGCTTCCGCCGCATTGCCTTCAACTTTGCC
TGGTCTGCCATCTACAACCTGCTGGCCATTCTTCTCGCCTCGGGTGCCTTTGTGAAAGTGCGTATCCCTCCCGCA
TACGCAGGCCTCGGCGAGATCGTCAGCGTCCTGCCTGTTGTTTTAGCGGCTATGACAATGCTTCTGAAAAAGATC
AAACTAGCGGAAGCCTGA
Gene >Hirsu2|11034
ATGGGTGCCGGAAACTGCTGCTCGAGTGGCGCAAGCCAGGACGCTGCGTCTCGTCCTGACGTCAACGGCCACGAC
CACGTCAACGGCCACGACCACGCCCATGACGGTTGCGCCTCTTCTCAGCAGAACCCCTGCTCTGAGCAGGGCGAG
TGCTGCGACGACGACAGCTGCTGCGACGACTCGCCGCCCAGCTGCTCCGCCACTCTCGTCTGCTGCGACTCCTAT
GAGGAGCGTTGCGATGGTGCGTCCCCGCCCGGTCCTCGCTTCGCGCAGCCGGCGGCTTCATCGATTTCGCATTCT
CACCTTCGCTCCTTAGAGAAATGCATCCTCGTCGCCGCCGCCCTCGAGTGCGAGAAGACGTGCGAGAACGATGCC
TTTGGCCAAGATGGTGCGGATAGTTTCCTGGCCCCTGACACTGACGTCACCTCGTTCCCTCTCGTTCTTCTCGCC
ACCACAGACCCAGTTCTCAACGTGGCGCTCTTGTTGAGAAGACGGCGAAACTCACGCTGACCGTCACGTTTTTCT
TCTAGGCACGCCCACTCACGAGCATGCCCACGACGAAGACGGCAAACATCCGACCTCGGCCTGCAGCACCCATCT
GGCCAAGGCTTTCGACCAGTACAGCGCCTACCTCGAGTCCGCGCGCTGCATCTGCCGCAGCATCCTCGACCGAGG
CTGGTCGACCACCTGTTGCGCCGAGCAGCCGAAGCAGGCGGCGGCCACCGGCAAGGCCACCGTCGACACGAAACG
AAGCGCCTTCACCAGCAGCCACGGATTGCACGGCCACGAGGGGCCCCATCACCATCATGGCGTGAAGCGCCGAGG
CAGGAAGACGCGCCGCCAGCACGACGACGCCCTCGTCATGCTCCAAGAGGTAGACAGCTGCTGCGGGGGCCACGA
TGCCCACCAGCACGACCACGCGGCCGTCGAGACGGACGGCAACATCAAAAGTTGGGATCTTGAAAAGGCTCAGGG
GCTCGAGCACGTTGCGCTCTCGGTCGACGGCATGACCTGTTCTGGATGCGGCAACAAGATGGAGCGTGCCCTCCG
GACCGCCCCGGGCGTCTCTTCGGCGCGAGTCAACTTCGTCATGGGGTCGGCCGAGTTCAGCCTCGACACCTCCAT
CGCCTCCCCGGACGATGTCGTTCGCGCGGCCGAGAAAGCCACGGGATTTCGCTGCACCAAACTGTTCAGCGACGA
CCAGACAATCGACGTGCTGGCCAGTGGCCACTCGGCCATGGCGCTTACCGACGCCCTGATCCCTGGCGTCACCCA
GGCCGCGGTCCTCGACAAGAAAGTCGTCCGCATCACCTACGACCCGGTGCTCATCGGAGCCAGGACTTTGATGGA
GAAGGTCGGGCCACTGTCGAATGGGCTGGCGCCCCCAGGCGATGACCCAAGCGTGTCCGGCGGTCGCAAGATTCT
CCACGACAAGCTCATGAAGACGGTGATCGCTGCTTGCTTCACCATACCAGTCCTGGTCCTGGCGTGGTCCGACCA
CCTCGTAGACGACAGGACCGAAGCCTACGTCTCCATCGTTCTCGCCACCGTGGTGCAACTGATCGCGGTGCCCGA
CTTTTATCAGCCGGCCATATCCGCCCTCGTCCACAGCGGTACCGTCGAGATGGACATGTTGGTGGTCATCAGCAT
CACGGCTGCGTACGTCTACTCGGTCGTCGCATTTAGCTTCGCCATGGCCGGCAAGCCGCTCGAGACCAAGGCCTT
CTTCGAGACGAGCACATTGCTCATAACGCTCGTTCTGCTTGGCCGTCTCATCGCCGCCTTCGCCCGCGTCAGGGC
CGTGGCTGCGGTTTCGCTTCGATCTCTCCAATCGGCCAAGGCTGTCATCATTGAAGATGGCGCGGACCGCGAGGT
CGACTCCCGTCTGCTACAATATGGTGACAAGCTGAGAGTAGGCCCCCATGCAGCTGTCCCTACCGACGCCACCGT
GATTGGTGGCTCGAGCGAGGTGGACGAGTCCATGATCACGGGTGAGAGCATCCCCGTGGTGAAAAAGGAGGGGGA
CGCCCTCATCGCAGGCACCATCAACGGCTCGGGCTCCCTGGCGGCGCTGCTGACGCGCCTCCCCGGCAAGAACAC
CGTGACGGACATCGCTCGGCTGGTAGAGGAGGCTGCCAGCTCAAAGCCCAGACTCCAGGACATTGCCGACCGCGT
CGCTGGGTGGTTTGTTCCCTTCGTCACAGCCGCGGCCCTCGTCGTCGTCGTCGTCTGGATTGTCGTCGGCCTCGA
AGTACGCGGCTACGGCGCAGGCAAAGCTATATCCAACGCCACCACCTTCGCTGTCGCGACCCTGGCCGTGTCATG
CCCCTGCGCAATCGGCCTCGCCGTTCCCATGGTCCTTGTTGTGGCCGGCGGTATTGCCGCCCGCAATGGCGTTAT
CATCAAGTCGGCCGAATGCACTGAGCGCGCTCGCAAGGTGACCGATGTCGTCTTCGACAAGACGGGGACCATCAC
CGAGCCTGACCTCGAGGTTGTGGACGAGCAGTTCTTCGCCGACAACCAGAAGGAGGCTGTTGCGGTCTGCAAGGC
ACTTGTCGCTGGGAACAAGCACCCAGTGTCGCTTGCCGTCGCCCGGCATCTCGAACAGCGTGGCTGCTCCGAGGT
CAGGCTGACCGACGTGCGTGTCATCCCTGGTGCGGGCGTCGATGCCAGCTTGAACGGCACGGCGATCCGTGCTGG
AAATCCAACTTGGACCAAGACGTCAAGTCATCCGGCCGTTTCCCGGCTGCAGGAGCATGGTGTCACGCTCCTTGT
CGTGACGCGCGGCGCTGAGCTCATTGCCCTATTCGCGATGCGCACTCGCCTTCGCGCCGAGGCGATCGGCGTCGT
CGCCAAGCTCGGGCGCCGCAACGTCGCCGTCCACCTTGTTTCCGGCGACCAGAAGGGCGCCGTCGATGCCGTGGC
TGCCAACGTTGGCATTTTGCATGTCGCCTCGCAGTGTACGCCTTCGCAGAAACGCGATTATGTCGCGGGCCTCAT
GGCTCGTGGCAGGACCGTCATGTTCGTCGGCGATGGTACCAATGACGCCGTCGCCGTAACACAGGCAGACGTGGG
CGTCCAGCTCGCCAATGTTCAGTCCGCCAGCGAAGTCACCCGAAGCGCCGCCGACGTAGTGCTTCTCAATGGCCT
CGAGGGAATCCCCTTCATTCTGCGCATCAGCGCCGTCAGCTTCCGCCGCATTGCCTTCAACTTTGCCTGGTCTGC
CATCTACAACCTGCTGGCCATTCTTCTCGCCTCGGGTGCCTTTGTGAAAGTGCGTATCCCTCCCGCATACGCAGG
CCTCGGCGAGATCGTCAGCGTCCTGCCTGTTGTTTTAGCGGCTATGACAATGCTTCTGAAAAAGATCAAACTAGC
GGAAGCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail