Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11020
Gene name
LocationContig_947:8665..10489
Strand+
Gene length (bp)1824
Transcript length (bp)1692
Coding sequence length (bp)1692
Protein length (aa) 564

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 5.9E-38 41 193
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 3.1E-37 217 386
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 1.9E-33 397 555

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 30 563 1.0E-78
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 49 505 4.0E-28
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 46 524 1.0E-23
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 44 523 2.0E-22
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 53 519 2.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 30 563 1.0E-78
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 49 505 4.0E-28
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 46 524 1.0E-23
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 44 523 2.0E-22
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 53 519 2.0E-22
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 93 500 6.0E-20
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 36 505 4.0E-19
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 50 520 8.0E-19
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 36 500 2.0E-18
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 45 555 9.0E-18
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 62 500 1.0E-17
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 39 513 2.0E-16
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 92 500 3.0E-16
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 62 505 1.0E-15
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 44 527 4.0E-14
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 92 555 6.0E-14
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 43 504 4.0E-13
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 42 503 3.0E-12
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 43 504 1.0E-11
sp|Q91YT8|CSCL1_MOUSE CSC1-like protein 1 OS=Mus musculus GN=Tmem63a PE=1 SV=1 93 504 2.0E-10
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 39 513 5.0E-10
sp|Q5R826|CSCL1_PONAB CSC1-like protein 1 OS=Pongo abelii GN=TMEM63A PE=2 SV=1 93 504 7.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 40 62 22
2 127 144 17
3 173 195 22
4 402 424 22
5 453 475 22
6 496 518 22
7 538 555 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11020
MDLPDLPPLPRLAARDGPDAAQELLKLLKNPFSVQLGPAALYSALGTSLGVTAFIAICFSFLRPYNQAIYAPRLK
HADEKHAPPPIGRKPWSWITPLLRTDESLLVRQIGMDAVVFLRFIRMCRNMFLVLALVGTAILIPVHLASTVKSY
DGGKTVTEWIIQITPSNVFGRAHWAQVVVAWLFNAVIAGFLWWNYRRVLQLRRQYFEGDDYQTSLHSRTLMLSDL
PRQACSDEGIARIIDQVVPNSSFARTAVARNVKDLPDLIDEHAHAVRTLEKILARYLRDPARLPPARPSCRPERR
DRAFDTYPRGQKLDAIDYYTQRIRDLEVEVREVRASVDKRGTMPYGFASYSDIAEAHAIAHACRRKRPRGARITL
APRPADITWRNMPLSSATRARRRWINNVWIAVLTLLWVGPNAMIAIFLVDLGNLGRVWPAFARSLAANRSFWGMV
QGIASPALMSLVYLVLPILFRRMSIKAGDQTKTGRERHVLGKMYAFFVFNNLVVFSFFSVVWSFVAGVVDTTNRD
HVNAWDAIQRQDLAAAAFVAFCNNGLFWVTSRARRRAS*
Coding >Hirsu2|11020
ATGGACCTCCCCGACCTGCCGCCCTTGCCCCGGCTCGCGGCCCGCGATGGCCCCGACGCCGCGCAGGAGCTGCTG
AAGCTGCTCAAGAACCCCTTCTCCGTCCAGCTCGGCCCCGCCGCCCTCTACTCGGCCCTGGGCACCTCGCTCGGC
GTCACCGCCTTCATCGCCATCTGCTTCTCCTTCCTGCGGCCCTACAACCAGGCCATCTACGCGCCCCGCCTCAAG
CACGCCGACGAGAAGCACGCGCCGCCGCCCATCGGCCGCAAGCCCTGGTCGTGGATCACGCCGCTGCTGCGGACC
GACGAGTCGCTCCTCGTCCGCCAGATCGGCATGGACGCCGTCGTCTTCCTGCGCTTCATCCGCATGTGCCGCAAC
ATGTTCCTCGTCCTCGCCCTCGTCGGCACCGCCATCCTCATCCCCGTCCACCTGGCCAGCACGGTCAAGTCGTAC
GACGGCGGCAAGACGGTGACGGAGTGGATCATCCAGATCACGCCCAGCAACGTCTTCGGCCGCGCCCACTGGGCC
CAGGTCGTCGTCGCCTGGCTCTTCAACGCCGTCATCGCCGGCTTCCTGTGGTGGAACTACCGCCGCGTCCTGCAG
CTGCGCCGCCAGTACTTCGAGGGCGACGACTACCAGACGAGCCTGCACTCGCGCACCCTCATGCTGTCCGACCTG
CCGCGCCAGGCCTGCTCCGACGAGGGCATCGCCCGCATCATCGACCAGGTCGTGCCCAACTCGTCCTTCGCCCGC
ACCGCCGTCGCCCGCAACGTCAAGGACCTGCCCGACCTCATCGACGAGCACGCCCACGCCGTCCGCACCCTCGAG
AAGATCCTGGCCCGCTACCTGCGCGACCCGGCCCGCCTGCCGCCCGCCCGCCCCTCGTGCCGGCCCGAGCGCCGC
GACCGCGCCTTCGACACGTACCCGCGCGGCCAGAAGCTCGACGCCATCGACTACTACACCCAGCGCATCCGCGAC
CTCGAGGTCGAGGTGCGCGAGGTGCGCGCCAGCGTCGACAAGCGCGGCACCATGCCCTACGGCTTCGCCTCGTAC
TCGGACATCGCCGAGGCCCACGCCATCGCCCACGCCTGCCGCCGCAAGCGCCCGCGCGGCGCCCGCATCACCCTG
GCCCCGCGGCCCGCCGACATCACCTGGCGCAACATGCCGCTGTCGAGCGCGACGCGCGCCCGCCGCCGCTGGATC
AACAACGTCTGGATCGCCGTCCTGACGCTGCTCTGGGTCGGCCCCAACGCCATGATCGCCATCTTCCTCGTCGAC
CTCGGCAACCTCGGCCGCGTCTGGCCCGCCTTCGCCCGCTCCCTCGCCGCCAACCGCTCCTTCTGGGGCATGGTC
CAGGGCATCGCCTCGCCCGCCCTCATGTCGCTCGTCTACCTCGTCCTGCCCATCCTCTTCCGCCGCATGTCCATC
AAGGCCGGCGACCAGACCAAGACGGGCCGCGAGCGCCACGTCCTCGGCAAGATGTACGCCTTCTTCGTCTTCAAC
AACCTCGTCGTCTTCTCCTTCTTCAGCGTCGTCTGGTCCTTCGTCGCCGGCGTCGTCGACACCACCAACCGCGAC
CACGTCAACGCCTGGGACGCCATCCAGCGCCAGGACCTGGCCGCCGCCGCCTTCGTCGCCTTCTGCAACAACGGC
CTCTTCTGGGTCACTTCTCGAGCCCGACGCCGCGCGAGCTGA
Transcript >Hirsu2|11020
ATGGACCTCCCCGACCTGCCGCCCTTGCCCCGGCTCGCGGCCCGCGATGGCCCCGACGCCGCGCAGGAGCTGCTG
AAGCTGCTCAAGAACCCCTTCTCCGTCCAGCTCGGCCCCGCCGCCCTCTACTCGGCCCTGGGCACCTCGCTCGGC
GTCACCGCCTTCATCGCCATCTGCTTCTCCTTCCTGCGGCCCTACAACCAGGCCATCTACGCGCCCCGCCTCAAG
CACGCCGACGAGAAGCACGCGCCGCCGCCCATCGGCCGCAAGCCCTGGTCGTGGATCACGCCGCTGCTGCGGACC
GACGAGTCGCTCCTCGTCCGCCAGATCGGCATGGACGCCGTCGTCTTCCTGCGCTTCATCCGCATGTGCCGCAAC
ATGTTCCTCGTCCTCGCCCTCGTCGGCACCGCCATCCTCATCCCCGTCCACCTGGCCAGCACGGTCAAGTCGTAC
GACGGCGGCAAGACGGTGACGGAGTGGATCATCCAGATCACGCCCAGCAACGTCTTCGGCCGCGCCCACTGGGCC
CAGGTCGTCGTCGCCTGGCTCTTCAACGCCGTCATCGCCGGCTTCCTGTGGTGGAACTACCGCCGCGTCCTGCAG
CTGCGCCGCCAGTACTTCGAGGGCGACGACTACCAGACGAGCCTGCACTCGCGCACCCTCATGCTGTCCGACCTG
CCGCGCCAGGCCTGCTCCGACGAGGGCATCGCCCGCATCATCGACCAGGTCGTGCCCAACTCGTCCTTCGCCCGC
ACCGCCGTCGCCCGCAACGTCAAGGACCTGCCCGACCTCATCGACGAGCACGCCCACGCCGTCCGCACCCTCGAG
AAGATCCTGGCCCGCTACCTGCGCGACCCGGCCCGCCTGCCGCCCGCCCGCCCCTCGTGCCGGCCCGAGCGCCGC
GACCGCGCCTTCGACACGTACCCGCGCGGCCAGAAGCTCGACGCCATCGACTACTACACCCAGCGCATCCGCGAC
CTCGAGGTCGAGGTGCGCGAGGTGCGCGCCAGCGTCGACAAGCGCGGCACCATGCCCTACGGCTTCGCCTCGTAC
TCGGACATCGCCGAGGCCCACGCCATCGCCCACGCCTGCCGCCGCAAGCGCCCGCGCGGCGCCCGCATCACCCTG
GCCCCGCGGCCCGCCGACATCACCTGGCGCAACATGCCGCTGTCGAGCGCGACGCGCGCCCGCCGCCGCTGGATC
AACAACGTCTGGATCGCCGTCCTGACGCTGCTCTGGGTCGGCCCCAACGCCATGATCGCCATCTTCCTCGTCGAC
CTCGGCAACCTCGGCCGCGTCTGGCCCGCCTTCGCCCGCTCCCTCGCCGCCAACCGCTCCTTCTGGGGCATGGTC
CAGGGCATCGCCTCGCCCGCCCTCATGTCGCTCGTCTACCTCGTCCTGCCCATCCTCTTCCGCCGCATGTCCATC
AAGGCCGGCGACCAGACCAAGACGGGCCGCGAGCGCCACGTCCTCGGCAAGATGTACGCCTTCTTCGTCTTCAAC
AACCTCGTCGTCTTCTCCTTCTTCAGCGTCGTCTGGTCCTTCGTCGCCGGCGTCGTCGACACCACCAACCGCGAC
CACGTCAACGCCTGGGACGCCATCCAGCGCCAGGACCTGGCCGCCGCCGCCTTCGTCGCCTTCTGCAACAACGGC
CTCTTCTGGGTCACTTCTCGAGCCCGACGCCGCGCGAGCTGA
Gene >Hirsu2|11020
ATGGACCTCCCCGACCTGCCGCCCTTGCCCCGGCTCGCGGCCCGCGATGGCCCCGACGCCGCGCAGGAGCTGCTG
AAGCTGCTCAAGAACCCCTTCTCCGTCCAGGTAAGCTGCCCGGCACCGGCCGCTGACGGGAACCGGCTGACCGTG
CCCAGCTCGGCCCCGCCGCCCTCTACTCGGCCCTGGGCACCTCGCTCGGCGTCACCGCCTTCATCGCCATCTGCT
TCTCCTTCCTGCGGCCCTACAACCAGGCCATCTACGCGCCCCGCCTCAAGCACGCCGACGAGAAGCACGCGCCGC
CGCCCATCGGCCGCAAGCCCTGGTCGTGGATCACGCCGCTGCTGCGGACCGACGAGTCGCTCCTCGTCCGCCAGA
TCGGCATGGACGCCGTCGTCTTCCTGCGCTTCATCCGCATGTGCCGCAACATGTTCCTCGTCCTCGCCCTCGTCG
GCACCGCCATCCTCATCCCCGTCCACCTGGCCAGCACGGTCAAGTCGTACGACGGCGGCAAGACGGTGACGGAGT
GGATCATCCAGATCACGCCCAGCAACGTCTTCGGCCGCGCCCACTGGGCCCAGGTCGTCGTCGCCTGGCTCTTCA
ACGCCGTCATCGCCGGCTTCCTGTGGTGGAACTACCGCCGCGTCCTGCAGCTGCGCCGCCAGTACTTCGAGGGCG
ACGACTACCAGACGAGCCTGCACTCGCGCACCCTCATGCTGTCCGACCTGCCGCGCCAGGCCTGCTCCGACGAGG
GCATCGCCCGCATCATCGACCAGGTCGTGCCCAACTCGTCCTTCGCCCGCACCGCCGTCGCCCGCAACGTCAAGG
ACCTGCCCGACCTCATCGACGAGCACGCCCACGCCGTCCGCACCCTCGAGAAGATCCTGGCCCGCTACCTGCGCG
ACCCGGCCCGCCTGCCGCCCGCCCGCCCCTCGTGCCGGCCCGAGCGCCGCGACCGCGCCTTCGACACGTACCCGC
GCGGCCAGAAGCTCGACGCCATCGACTACTACACCCAGCGCATCCGCGACCTCGAGGTCGAGGTGCGCGAGGTGC
GCGCCAGCGTCGACAAGCGCGGCACCATGCCCTACGGCTTCGCCTCGTACTCGGACATCGCCGAGGCCCACGCCA
TCGCCCACGCCTGCCGCCGCAAGCGCCCGCGCGGCGCCCGCATCACCCTGGCCCCGCGGCCCGCCGACATCACCT
GGCGCAACATGCCGCTGTCGAGCGCGACGCGCGCCCGCCGCCGCTGGATCAACAACGTCTGGATCGCCGTCCTGA
CGCTGCTCTGGGTCGGCCCCAACGCCATGATCGCCATCTTCCTCGTCGACCTCGGCAACCTCGGCCGCGTCTGGC
CCGCCTTCGCCCGCTCCCTCGCCGCCAACCGCTCCTTCTGGGGCATGGTCCAGGGCATCGCCTCGCCCGCCCTCA
TGTCGCTCGTCTACCTCGTCCTGCCCATCCTCTTCCGCCGCATGTCCATCAAGGCCGGCGACCAGACCAAGACGG
GCCGCGAGCGCCACGTCCTCGGCAAGATGTACGCCTTCTTCGTCTTCAACAACCTCGTCGTCTTCTCCTTCTTCA
GCGTCGTCTGGTCCTTCGTCGCCGGCGTCGTCGACACCACCAACCGCGACCACGTCAACGCCTGGGACGCCATCC
AGCGCCAGGACCTGGCCGCCGCCGCCTTCGTCGCCTTCTGCAACAACGGCCTCTTCTGGGTCACGTACCTGCTGC
AGCGCCAGCTCGGCGCCGCCATCGACCTGGCCCAGATCTGGCCCCTCGTCCAGGCCTTCTTCCTCAAGAAGTTCT
CGAGCCCGACGCCGCGCGAGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail