Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1102
Gene name
LocationContig_1230:6712..7870
Strand-
Gene length (bp)1158
Transcript length (bp)1092
Coding sequence length (bp)1092
Protein length (aa) 364

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16016 VASt VAD1 Analog of StAR-related lipid transfer domain 9.8E-32 6 131

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06681|YSP2_YEAST Membrane-anchored lipid-binding protein YSP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP2 PE=1 SV=1 34 150 8.0E-27
sp|Q06681|YSP2_YEAST Membrane-anchored lipid-binding protein YSP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP2 PE=1 SV=1 36 153 9.0E-25
sp|O42976|YGZ7_SCHPO Uncharacterized membrane protein C20F10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC20F10.07 PE=1 SV=1 35 147 8.0E-24
sp|P38800|LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM4 PE=1 SV=1 35 133 3.0E-23
sp|P38800|LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM4 PE=1 SV=1 1 281 7.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06681|YSP2_YEAST Membrane-anchored lipid-binding protein YSP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP2 PE=1 SV=1 34 150 8.0E-27
sp|Q06681|YSP2_YEAST Membrane-anchored lipid-binding protein YSP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP2 PE=1 SV=1 36 153 9.0E-25
sp|O42976|YGZ7_SCHPO Uncharacterized membrane protein C20F10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC20F10.07 PE=1 SV=1 35 147 8.0E-24
sp|P38800|LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM4 PE=1 SV=1 35 133 3.0E-23
sp|P38800|LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM4 PE=1 SV=1 1 281 7.0E-22
sp|Q08001|LAM6_YEAST Membrane-anchored lipid-binding protein LAM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM6 PE=1 SV=1 39 164 4.0E-15
sp|P43560|LAM5_YEAST Membrane-anchored lipid-binding protein LAM5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM5 PE=1 SV=2 39 136 9.0E-15
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide|Transmembrane domain|Peroxisomal targeting signal 0.1226 0.3307 0.0666 0.0721 0.4047 0.0969 0.9345 0.1517 0.3864 0.3269

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 216 238 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup676
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7977
Ophiocordyceps australis map64 (Brazil) OphauB2|7566
Ophiocordyceps camponoti-floridani Ophcf2|03948
Ophiocordyceps camponoti-rufipedis Ophun1|3151
Ophiocordyceps kimflemingae Ophio5|7979
Ophiocordyceps subramaniannii Hirsu2|1102 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5891

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1102
MFGPASVDWMARWLTGDQQKCTDLQMEDRRGLGPDNRSRNFTYVKPLNASLGPKQTKCIVAETLENMDLERAVNL
SVSTQNPDVPSGNVFCVKTKYCLSWAENSCTRVQVNCTTEWTGKSWLKGPIEKGVGDGQMQYCRDLFAALKSAVS
SRSRPGVPSGGAPRIKKKLKRSKALQSADGSVEGGGGLARADTKNWGPLEPVRGLAEPLLDVVRPVLTSNVMYGL
LVGLLVAMWFGFGSSPTKNSASYGPEVGYYSPSRLAAYEEMWRREESELWDWLEERVGLDRLSSDASNGVGGVGG
VGGKRTMAGRSVEDKLRDGQMDERDVEAAIWVTEEKLKVLKDAFGRNGRVTDRERESGRRGER*
Coding >Hirsu2|1102
ATGTTCGGCCCGGCCTCGGTCGACTGGATGGCCCGGTGGCTGACGGGCGACCAGCAGAAGTGCACCGACCTGCAG
ATGGAGGACCGGAGGGGCCTGGGCCCGGACAACCGGTCGCGCAACTTCACCTACGTCAAGCCGCTCAACGCGTCG
CTCGGCCCCAAGCAGACCAAGTGCATCGTGGCCGAGACGCTCGAGAACATGGACCTGGAGAGGGCCGTCAACCTG
AGCGTGTCGACGCAGAACCCGGACGTGCCCAGCGGCAACGTCTTTTGCGTCAAGACCAAGTACTGCCTGTCGTGG
GCCGAGAACAGCTGCACCCGCGTCCAGGTCAACTGCACGACGGAGTGGACGGGCAAGAGCTGGCTGAAAGGGCCG
ATCGAGAAGGGCGTCGGCGACGGGCAAATGCAGTACTGCAGGGACCTGTTCGCGGCCCTCAAGAGCGCGGTGTCG
TCGAGGAGCCGGCCGGGCGTCCCGTCGGGCGGCGCGCCGAGGATCAAGAAGAAGCTGAAGCGGAGCAAGGCGCTC
CAGTCGGCGGACGGCAGCGTCGAGGGCGGCGGCGGACTGGCGCGCGCCGACACGAAGAACTGGGGCCCGCTGGAG
CCGGTCAGAGGGCTGGCGGAGCCGCTGCTGGACGTGGTGCGGCCGGTGCTGACGAGCAACGTCATGTACGGGCTG
CTGGTGGGCCTGCTGGTGGCCATGTGGTTCGGGTTCGGCTCGTCGCCGACCAAGAACTCGGCGTCGTACGGGCCC
GAGGTGGGCTACTACAGCCCGAGCCGGCTGGCGGCGTACGAGGAGATGTGGCGGCGGGAGGAGAGCGAGCTCTGG
GACTGGCTGGAGGAGCGGGTCGGGCTGGACCGACTGAGCTCGGACGCGTCGAACGGCGTCGGCGGCGTCGGCGGC
GTCGGCGGCAAGAGGACGATGGCGGGACGGAGCGTCGAGGACAAGCTGAGGGACGGGCAGATGGACGAGAGGGAC
GTCGAGGCGGCCATCTGGGTGACGGAGGAGAAGCTCAAGGTGCTGAAGGACGCCTTTGGCCGGAACGGCCGCGTC
ACGGACCGCGAGAGGGAGAGCGGGCGGAGGGGCGAGCGGTGA
Transcript >Hirsu2|1102
ATGTTCGGCCCGGCCTCGGTCGACTGGATGGCCCGGTGGCTGACGGGCGACCAGCAGAAGTGCACCGACCTGCAG
ATGGAGGACCGGAGGGGCCTGGGCCCGGACAACCGGTCGCGCAACTTCACCTACGTCAAGCCGCTCAACGCGTCG
CTCGGCCCCAAGCAGACCAAGTGCATCGTGGCCGAGACGCTCGAGAACATGGACCTGGAGAGGGCCGTCAACCTG
AGCGTGTCGACGCAGAACCCGGACGTGCCCAGCGGCAACGTCTTTTGCGTCAAGACCAAGTACTGCCTGTCGTGG
GCCGAGAACAGCTGCACCCGCGTCCAGGTCAACTGCACGACGGAGTGGACGGGCAAGAGCTGGCTGAAAGGGCCG
ATCGAGAAGGGCGTCGGCGACGGGCAAATGCAGTACTGCAGGGACCTGTTCGCGGCCCTCAAGAGCGCGGTGTCG
TCGAGGAGCCGGCCGGGCGTCCCGTCGGGCGGCGCGCCGAGGATCAAGAAGAAGCTGAAGCGGAGCAAGGCGCTC
CAGTCGGCGGACGGCAGCGTCGAGGGCGGCGGCGGACTGGCGCGCGCCGACACGAAGAACTGGGGCCCGCTGGAG
CCGGTCAGAGGGCTGGCGGAGCCGCTGCTGGACGTGGTGCGGCCGGTGCTGACGAGCAACGTCATGTACGGGCTG
CTGGTGGGCCTGCTGGTGGCCATGTGGTTCGGGTTCGGCTCGTCGCCGACCAAGAACTCGGCGTCGTACGGGCCC
GAGGTGGGCTACTACAGCCCGAGCCGGCTGGCGGCGTACGAGGAGATGTGGCGGCGGGAGGAGAGCGAGCTCTGG
GACTGGCTGGAGGAGCGGGTCGGGCTGGACCGACTGAGCTCGGACGCGTCGAACGGCGTCGGCGGCGTCGGCGGC
GTCGGCGGCAAGAGGACGATGGCGGGACGGAGCGTCGAGGACAAGCTGAGGGACGGGCAGATGGACGAGAGGGAC
GTCGAGGCGGCCATCTGGGTGACGGAGGAGAAGCTCAAGGTGCTGAAGGACGCCTTTGGCCGGAACGGCCGCGTC
ACGGACCGCGAGAGGGAGAGCGGGCGGAGGGGCGAGCGGTGA
Gene >Hirsu2|1102
ATGTTCGGCCCGGCCTCGGTCGACTGGATGGCCCGGTGGCTGACGGGCGACCAGCAGAAGTGCACCGACCTGCAG
ATGGAGGACCGGAGGGGCCTGGGCCCGGACAACCGGTCGCGCAACTTCACCTACGTCAAGCCGCTCAACGCGTCG
CTCGGCCCCAAGCAGACCAAGTGCATCGTGGCCGAGACGCTCGAGAACATGGACCTGGAGAGGGCCGTCAACCTG
AGCGTGTCGACGCAGAACCCGGACGTGCCCAGCGGCAACGTCTTTTGCGTCAAGACCAAGTACTGCCTGTCGTGG
GCCGAGAACAGCTGCACCCGCGTCCAGGTCAACTGCACGACGGAGTGGACGGGCAAGAGCTGGCTGAAAGGTGCG
TACAGGACGAAGGAGGGCCGAGCCGTCGAGCCGTGAAACTGACAAACTCTCTCCTCCGCAGGGCCGATCGAGAAG
GGCGTCGGCGACGGGCAAATGCAGTACTGCAGGGACCTGTTCGCGGCCCTCAAGAGCGCGGTGTCGTCGAGGAGC
CGGCCGGGCGTCCCGTCGGGCGGCGCGCCGAGGATCAAGAAGAAGCTGAAGCGGAGCAAGGCGCTCCAGTCGGCG
GACGGCAGCGTCGAGGGCGGCGGCGGACTGGCGCGCGCCGACACGAAGAACTGGGGCCCGCTGGAGCCGGTCAGA
GGGCTGGCGGAGCCGCTGCTGGACGTGGTGCGGCCGGTGCTGACGAGCAACGTCATGTACGGGCTGCTGGTGGGC
CTGCTGGTGGCCATGTGGTTCGGGTTCGGCTCGTCGCCGACCAAGAACTCGGCGTCGTACGGGCCCGAGGTGGGC
TACTACAGCCCGAGCCGGCTGGCGGCGTACGAGGAGATGTGGCGGCGGGAGGAGAGCGAGCTCTGGGACTGGCTG
GAGGAGCGGGTCGGGCTGGACCGACTGAGCTCGGACGCGTCGAACGGCGTCGGCGGCGTCGGCGGCGTCGGCGGC
AAGAGGACGATGGCGGGACGGAGCGTCGAGGACAAGCTGAGGGACGGGCAGATGGACGAGAGGGACGTCGAGGCG
GCCATCTGGGTGACGGAGGAGAAGCTCAAGGTGCTGAAGGACGCCTTTGGCCGGAACGGCCGCGTCACGGACCGC
GAGAGGGAGAGCGGGCGGAGGGGCGAGCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail