Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11018
Gene name
LocationContig_947:1041..2283
Strand+
Gene length (bp)1242
Transcript length (bp)1176
Coding sequence length (bp)1176
Protein length (aa) 392

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03403 PAF-AH_p_II Platelet-activating factor acetylhydrolase, isoform II 1.1E-10 127 165
PF03403 PAF-AH_p_II Platelet-activating factor acetylhydrolase, isoform II 6.0E-05 218 268
PF12740 Chlorophyllase2 Chlorophyllase enzyme 1.2E-06 128 249

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AZY1|A1751_ARTBC Probable 1-alkyl-2-acetylglycerophosphocholine esterase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01751 PE=1 SV=1 1 370 1.0E-26
sp|Q28017|PAFA_BOVIN Platelet-activating factor acetylhydrolase OS=Bos taurus GN=PLA2G7 PE=2 SV=1 127 273 6.0E-13
sp|Q13093|PAFA_HUMAN Platelet-activating factor acetylhydrolase OS=Homo sapiens GN=PLA2G7 PE=1 SV=1 127 273 6.0E-13
sp|Q99487|PAFA2_HUMAN Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Homo sapiens GN=PAFAH2 PE=1 SV=1 119 263 7.0E-10
sp|Q60963|PAFA_MOUSE Platelet-activating factor acetylhydrolase OS=Mus musculus GN=Pla2g7 PE=2 SV=2 127 359 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AZY1|A1751_ARTBC Probable 1-alkyl-2-acetylglycerophosphocholine esterase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01751 PE=1 SV=1 1 370 1.0E-26
sp|Q28017|PAFA_BOVIN Platelet-activating factor acetylhydrolase OS=Bos taurus GN=PLA2G7 PE=2 SV=1 127 273 6.0E-13
sp|Q13093|PAFA_HUMAN Platelet-activating factor acetylhydrolase OS=Homo sapiens GN=PLA2G7 PE=1 SV=1 127 273 6.0E-13
sp|Q99487|PAFA2_HUMAN Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Homo sapiens GN=PAFAH2 PE=1 SV=1 119 263 7.0E-10
sp|Q60963|PAFA_MOUSE Platelet-activating factor acetylhydrolase OS=Mus musculus GN=Pla2g7 PE=2 SV=2 127 359 2.0E-09
sp|P79106|PAFA2_BOVIN Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Bos taurus GN=PAFAH2 PE=1 SV=1 120 263 6.0E-09
sp|P83006|PAFA2_RAT Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Rattus norvegicus GN=Pafah2 PE=1 SV=2 129 263 1.0E-07
sp|Q8VDG7|PAFA2_MOUSE Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Mus musculus GN=Pafah2 PE=1 SV=2 129 263 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016042 lipid catabolic process Yes
GO:0003847 1-alkyl-2-acetylglycerophosphocholine esterase activity Yes
GO:1901575 organic substance catabolic process No
GO:0006629 lipid metabolic process No
GO:0052689 carboxylic ester hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0009056 catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11018
MLLLPVVVVAAVLAAVQAVRVPGPTGPYPVAMRVQQLTDQRRLDPYAPPGRPHKRRILVSVFLPLDPGRFADGPV
QSVPYMPPRTAALYGDEAVRESPLPRDFFSRLTIDFSQFPKNGSTSDEGHRRRYPVVLFSHGLGGSRLLHTAAAR
DIASQGYVVMTIDHPYDASYVEFPDGSEVRGANISTMPAIIRSVQVRAADVSFLVDQLHDSAALQRLTAGMAGGV
DADKVVVCGHSLGGATSAAVMANDSRIAGGLDLDGHIIGPVADEGFDRPFALVGKPGRGQTAGSKWPELYSRLRG
PKMELAVAETEHLSFFDVPLLLTTAKVADGDRPRLDAALGRVNGRRLRGITMGIFTAFLDLVFRGKADGLRNLDK
DFCGVSVVKSELPQGS*
Coding >Hirsu2|11018
ATGCTGCTGCTGCCCGTTGTCGTCGTCGCGGCTGTCCTGGCGGCCGTCCAGGCCGTTCGGGTCCCCGGCCCGACG
GGTCCGTATCCGGTCGCGATGCGAGTCCAGCAGCTGACGGACCAGCGGCGCCTCGACCCGTACGCGCCCCCGGGC
AGGCCTCACAAGAGGCGCATCCTCGTCTCCGTCTTTCTGCCGCTCGACCCCGGGCGCTTCGCCGACGGCCCCGTG
CAGAGCGTGCCATACATGCCGCCCCGCACCGCGGCTCTGTACGGCGACGAGGCTGTCAGAGAGTCTCCCCTGCCC
CGGGATTTCTTTTCCCGCCTCACCATCGACTTCTCGCAGTTTCCCAAGAACGGCAGCACGAGCGACGAGGGCCAC
CGGCGGCGATACCCCGTTGTCCTCTTCTCACACGGGCTCGGCGGGTCGAGACTGCTGCACACGGCTGCCGCGCGG
GACATCGCCAGCCAGGGCTATGTGGTGATGACCATCGACCATCCTTACGACGCCTCCTATGTGGAATTCCCCGAC
GGCTCCGAGGTCCGCGGCGCCAACATATCGACGATGCCGGCCATCATTCGGTCGGTCCAGGTTCGCGCGGCAGAC
GTCTCGTTCCTCGTCGATCAGCTGCACGACTCGGCGGCTCTGCAGCGGCTAACGGCCGGGATGGCCGGCGGCGTC
GACGCGGACAAGGTGGTCGTCTGCGGGCACTCGCTGGGGGGCGCGACGAGCGCGGCCGTCATGGCCAACGACAGC
CGCATCGCGGGGGGCCTGGACCTGGACGGGCACATCATCGGGCCGGTCGCCGACGAGGGCTTCGACAGGCCGTTT
GCGCTGGTGGGAAAGCCCGGGCGCGGGCAGACGGCCGGGTCCAAGTGGCCCGAGCTGTACTCTCGCCTGCGGGGG
CCCAAGATGGAGCTGGCCGTGGCCGAGACGGAGCACCTGTCGTTCTTCGACGTGCCGCTGCTGCTGACGACGGCC
AAGGTGGCCGACGGCGACCGGCCCAGGCTGGACGCGGCGCTCGGGCGCGTCAACGGACGCCGGCTGCGCGGCATC
ACCATGGGCATCTTCACCGCCTTCCTCGACCTCGTATTCAGGGGCAAGGCGGACGGGCTGCGCAACCTGGACAAG
GACTTTTGCGGCGTGTCCGTGGTGAAGAGCGAGCTCCCGCAAGGCTCGTGA
Transcript >Hirsu2|11018
ATGCTGCTGCTGCCCGTTGTCGTCGTCGCGGCTGTCCTGGCGGCCGTCCAGGCCGTTCGGGTCCCCGGCCCGACG
GGTCCGTATCCGGTCGCGATGCGAGTCCAGCAGCTGACGGACCAGCGGCGCCTCGACCCGTACGCGCCCCCGGGC
AGGCCTCACAAGAGGCGCATCCTCGTCTCCGTCTTTCTGCCGCTCGACCCCGGGCGCTTCGCCGACGGCCCCGTG
CAGAGCGTGCCATACATGCCGCCCCGCACCGCGGCTCTGTACGGCGACGAGGCTGTCAGAGAGTCTCCCCTGCCC
CGGGATTTCTTTTCCCGCCTCACCATCGACTTCTCGCAGTTTCCCAAGAACGGCAGCACGAGCGACGAGGGCCAC
CGGCGGCGATACCCCGTTGTCCTCTTCTCACACGGGCTCGGCGGGTCGAGACTGCTGCACACGGCTGCCGCGCGG
GACATCGCCAGCCAGGGCTATGTGGTGATGACCATCGACCATCCTTACGACGCCTCCTATGTGGAATTCCCCGAC
GGCTCCGAGGTCCGCGGCGCCAACATATCGACGATGCCGGCCATCATTCGGTCGGTCCAGGTTCGCGCGGCAGAC
GTCTCGTTCCTCGTCGATCAGCTGCACGACTCGGCGGCTCTGCAGCGGCTAACGGCCGGGATGGCCGGCGGCGTC
GACGCGGACAAGGTGGTCGTCTGCGGGCACTCGCTGGGGGGCGCGACGAGCGCGGCCGTCATGGCCAACGACAGC
CGCATCGCGGGGGGCCTGGACCTGGACGGGCACATCATCGGGCCGGTCGCCGACGAGGGCTTCGACAGGCCGTTT
GCGCTGGTGGGAAAGCCCGGGCGCGGGCAGACGGCCGGGTCCAAGTGGCCCGAGCTGTACTCTCGCCTGCGGGGG
CCCAAGATGGAGCTGGCCGTGGCCGAGACGGAGCACCTGTCGTTCTTCGACGTGCCGCTGCTGCTGACGACGGCC
AAGGTGGCCGACGGCGACCGGCCCAGGCTGGACGCGGCGCTCGGGCGCGTCAACGGACGCCGGCTGCGCGGCATC
ACCATGGGCATCTTCACCGCCTTCCTCGACCTCGTATTCAGGGGCAAGGCGGACGGGCTGCGCAACCTGGACAAG
GACTTTTGCGGCGTGTCCGTGGTGAAGAGCGAGCTCCCGCAAGGCTCGTGA
Gene >Hirsu2|11018
ATGCTGCTGCTGCCCGTTGTCGTCGTCGCGGCTGTCCTGGCGGCCGTCCAGGCCGTTCGGGTCCCCGGCCCGACG
GGTCCGTATCCGGTCGCGATGCGAGTCCAGCAGCTGACGGACCAGCGGCGCCTCGACCCGTACGCGCCCCCGGGC
AGGCCTCACAAGAGGCGCATCCTCGTCTCCGTCTTTCTGCCGCTCGACCCCGGGCGCTTCGCCGACGGCCCCGTG
CAGAGCGTGCCATACATGCCGCCCCGCACCGCGGCTCTGTACGGCGACGAGGCTGTCAGAGAGTCTCCCCTGCCC
CGGGATTTCTTTTCCCGCCTCACCATCGACTTCTCGCAGTTTCCCAAGAACGGCAGCACGAGCGACGAGGGCCAC
CGGCGGCGATACCCCGTTGTCCTCTTCTCACACGGGCTCGGCGGGTCGAGACTGCTGCACACGGCTGCCGCGCGG
GACATCGCCAGCCAGGGCTATGTGGTGATGACCATCGACCATCCTTACGACGCCTCCTATGTGGAATTCCCCGAC
GGCTCCGAGGTCCGCGGCGCCAACATATCGACGATGCCGGCCATCATTCGGTCGGTCCAGGTCAGTTGGCAGGTC
TCGCCCGGCGTTGATGGGTCTCATCGTTGACGGGGGCATCCTCCTCGGCAGGTTCGCGCGGCAGACGTCTCGTTC
CTCGTCGATCAGCTGCACGACTCGGCGGCTCTGCAGCGGCTAACGGCCGGGATGGCCGGCGGCGTCGACGCGGAC
AAGGTGGTCGTCTGCGGGCACTCGCTGGGGGGCGCGACGAGCGCGGCCGTCATGGCCAACGACAGCCGCATCGCG
GGGGGCCTGGACCTGGACGGGCACATCATCGGGCCGGTCGCCGACGAGGGCTTCGACAGGCCGTTTGCGCTGGTG
GGAAAGCCCGGGCGCGGGCAGACGGCCGGGTCCAAGTGGCCCGAGCTGTACTCTCGCCTGCGGGGGCCCAAGATG
GAGCTGGCCGTGGCCGAGACGGAGCACCTGTCGTTCTTCGACGTGCCGCTGCTGCTGACGACGGCCAAGGTGGCC
GACGGCGACCGGCCCAGGCTGGACGCGGCGCTCGGGCGCGTCAACGGACGCCGGCTGCGCGGCATCACCATGGGC
ATCTTCACCGCCTTCCTCGACCTCGTATTCAGGGGCAAGGCGGACGGGCTGCGCAACCTGGACAAGGACTTTTGC
GGCGTGTCCGTGGTGAAGAGCGAGCTCCCGCAAGGCTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail