Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11016
Gene name
LocationContig_946:5057..6842
Strand-
Gene length (bp)1785
Transcript length (bp)900
Coding sequence length (bp)900
Protein length (aa) 300

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 8.2E-16 73 164
PF13489 Methyltransf_23 Methyltransferase domain 6.2E-15 65 224
PF08241 Methyltransf_11 Methyltransferase domain 2.5E-13 74 166
PF08242 Methyltransf_12 Methyltransferase domain 1.2E-10 74 165
PF13847 Methyltransf_31 Methyltransferase domain 1.7E-10 71 172
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 4.6E-05 69 171
PF02390 Methyltransf_4 Putative methyltransferase 7.5E-05 73 106

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11016
MDPEDGTAPLDESLTETIELLGRTYQKYALVAGTYFAPIDEEEISRLELMHSVLCRVFDDRLIFPPVGAPNRVLD
CGCGAGDWAVDVARRFPECEVLGIDVSPHMIPEDPPNNLEIQIDDLNGRFTFPPDHFDVVHSQMMAGGIHANRWR
SYVQDIFRVLRPGGWCQMVEVYFNAQSDNGTLGRDDALSRWSSQYLNTLHPRKDPRAALQLPSWMRSAGFKEVES
RLLTLPMCAWPVEAEARQRDIGAANRENVAQLLHSLALYPFTQLRGMPLNEFDRLVDEARREASNPSFKAYFPL*
Coding >Hirsu2|11016
ATGGATCCAGAGGACGGAACGGCGCCTCTCGACGAATCCCTCACGGAAACCATCGAGTTGCTTGGTCGAACGTAC
CAGAAGTATGCTCTGGTGGCCGGCACGTACTTTGCACCAATCGACGAGGAGGAGATTTCGCGTCTGGAATTGATG
CACTCTGTGCTATGCAGAGTCTTCGACGACCGGCTCATCTTCCCTCCCGTGGGCGCGCCAAACAGGGTCCTGGAC
TGCGGCTGCGGAGCGGGAGACTGGGCCGTCGACGTCGCGAGACGATTCCCCGAGTGCGAGGTCCTAGGGATAGAC
GTCAGTCCTCACATGATCCCCGAGGATCCGCCCAACAATCTCGAAATCCAGATCGACGACCTGAATGGGAGATTT
ACCTTTCCGCCAGACCACTTCGACGTTGTACACAGCCAGATGATGGCTGGCGGGATTCACGCGAACCGATGGCGA
AGCTATGTGCAGGACATCTTCCGGGTGCTGCGGCCGGGCGGCTGGTGCCAGATGGTCGAAGTCTACTTCAACGCG
CAGTCGGACAACGGAACGCTTGGAAGAGATGATGCCTTGTCGCGGTGGTCGAGCCAATACCTCAACACGCTGCAT
CCACGGAAGGATCCCAGAGCGGCCCTGCAGCTTCCAAGCTGGATGAGGAGCGCCGGATTCAAGGAGGTCGAGTCC
AGGCTACTGACGCTGCCCATGTGCGCGTGGCCAGTTGAGGCAGAAGCCCGACAGCGCGATATCGGGGCCGCCAAC
CGCGAGAACGTGGCTCAGCTGCTTCACTCGCTGGCGCTGTATCCGTTCACCCAGCTGCGAGGCATGCCGTTGAAC
GAGTTCGACCGCCTCGTCGACGAAGCGAGGAGGGAGGCGAGCAATCCCTCATTCAAGGCATATTTCCCTCTGTGA
Transcript >Hirsu2|11016
ATGGATCCAGAGGACGGAACGGCGCCTCTCGACGAATCCCTCACGGAAACCATCGAGTTGCTTGGTCGAACGTAC
CAGAAGTATGCTCTGGTGGCCGGCACGTACTTTGCACCAATCGACGAGGAGGAGATTTCGCGTCTGGAATTGATG
CACTCTGTGCTATGCAGAGTCTTCGACGACCGGCTCATCTTCCCTCCCGTGGGCGCGCCAAACAGGGTCCTGGAC
TGCGGCTGCGGAGCGGGAGACTGGGCCGTCGACGTCGCGAGACGATTCCCCGAGTGCGAGGTCCTAGGGATAGAC
GTCAGTCCTCACATGATCCCCGAGGATCCGCCCAACAATCTCGAAATCCAGATCGACGACCTGAATGGGAGATTT
ACCTTTCCGCCAGACCACTTCGACGTTGTACACAGCCAGATGATGGCTGGCGGGATTCACGCGAACCGATGGCGA
AGCTATGTGCAGGACATCTTCCGGGTGCTGCGGCCGGGCGGCTGGTGCCAGATGGTCGAAGTCTACTTCAACGCG
CAGTCGGACAACGGAACGCTTGGAAGAGATGATGCCTTGTCGCGGTGGTCGAGCCAATACCTCAACACGCTGCAT
CCACGGAAGGATCCCAGAGCGGCCCTGCAGCTTCCAAGCTGGATGAGGAGCGCCGGATTCAAGGAGGTCGAGTCC
AGGCTACTGACGCTGCCCATGTGCGCGTGGCCAGTTGAGGCAGAAGCCCGACAGCGCGATATCGGGGCCGCCAAC
CGCGAGAACGTGGCTCAGCTGCTTCACTCGCTGGCGCTGTATCCGTTCACCCAGCTGCGAGGCATGCCGTTGAAC
GAGTTCGACCGCCTCGTCGACGAAGCGAGGAGGGAGGCGAGCAATCCCTCATTCAAGGCATATTTCCCTCTGTGA
Gene >Hirsu2|11016
ATGGATCCAGAGTCAGAATTTCACTCGTGGACGGAAGCGCGAGGAGCACGACTGACGGCCTCTGAAGGGACGGAA
CGGCGCCTCTCGACGAATCCCTCACGGAAACCATCGAGTTGCTTGGTCGAACGTACCAGAAGTATGCTCTGGTGG
CCGGCACGTACTTTGCACCAATCGACGAGGTAAGACAGGGGTCCTTTTCCACGGCCAGGGCAGGCTGAAAAAGCT
GGCTGCGGTATAGCTGACGAGACCGTGGACAGGAGGAGATTTCGCGTCTGGAATTGATGCACTCTGTGCTATGCA
GAGTCTTCGACGACCGGCTCATCTTCCCTCCCGTGGGCGCGCCAAACAGGGTCCTGGACTGCGGCTGCGGAGCGG
GAGACTGGGCCGTCGACGTCGCGAGACGATTCCCCGAGTGCGAGGTGCGTTTTCGATTTCGAACGCGGTTGTTCG
TGCCGACGCGACTGTGCACATGACCGCCAGACTGCATCGGCAGCTCCCGACTTCCACAGAAGCCGAAAAGGCGAA
GATACGGAGTTTCCTGCTTCGTGGCCAGGCGTGCCGGTTCGGGCCTTCAGGTCCTCCCCTCCCAGCATGTCGCGA
TGGCTATACTCTTTTCATCCCTCTCTTGTCCACCTGGTGGCGAGACTTGTCACCCCGGTGGCGAGGCTTGTCCCG
AGCGGATGTCGATGCACCAGACTGGTGTCTTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTTTCGA
TCGTCCAAGCTAACGAGACTGGCCAGGTCCTAGGGATAGACGTCAGTCCTCACATGATCCCCGAGGATCCGCCCA
ACAATCTCGAAATCCAGATCGACGACCTGAATGGGAGGTTGGCAGTGCCACCAGAATGGCGCGTGCAGAAGAGGT
GCTAAGGGTACTGCGGCAGATTTACCTTTCCGCCAGACCACTTCGACGTTGTACACAGCCAGATGATGGCTGGCG
GGATTCACGCGAACCGATGGCGAAGCTATGTGCAGGACATCTTCCGGGTGCTGCGGCCGGGCGGCTGGTGCCAGA
TGGTCGAAGTCTACTTCAACGCGCAGTCGGACAACGGAACGCTTGGAAGAGGCAAGCAGCCCACAAGGTCCCGGA
TGTCTGACGAGGTCGGACGGGAGAGCGGCGGCTGTGCTGACCCGGGCCGAGGACGGATAGATGATGCCTTGTCGC
GGTGGTCGAGCCAATACCTCAACACGCTGCATCCACGGAAGGATCCCAGAGCGGCCCTGCAGCTTCCAAGCTGGA
TGAGGAGCGCCGGATTCAAGGAGGTCGAGTCCAGGCTACTGACGCTGCCCATGTGCGCGTGGCCAGTTGGTATTG
TTCCCCCCTACTCCCAGAGTGCCTGCAGGCATGGAGCCTAAGGAGAAAGGGGCCTGACCGGAAACCAAAACAAAC
GGATGAAAAGAGGCAGAAGCCCGACAGCGCGATATCGGGGCCGCCAACCGCGAGAACGTGGCTCAGCTGCTTCAC
TCGCTGGCGCTGTATCCGTTCACCCAGCTGCGAGGGTAAGAAGTCGGCGACCGTGGCGTGGTACGGGACTAAGGT
TTCGGCAGCATGCCGTTGAACGAGTTCGACCGCCTCGTCGACGAAGCGAGGAGGGAGGCGAGCAATCCCTCATTC
AAGGTGCGCGTTCCGGAGAGGAAGGCGAGGTGCTGGTCATTGGCGGCCGGTGCCTGTCGTCGATGCCGGCCACGG
GGTTGCGGGCGACAACGGCGCTGACGCTTTGACCGGTGGCAGGCATATTTCCCTCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail