Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11016
Gene name
LocationContig_946:5057..6842
Strand-
Gene length (bp)1785
Transcript length (bp)900
Coding sequence length (bp)900
Protein length (aa) 300

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 8.7E-16 73 164
PF13489 Methyltransf_23 Methyltransferase domain 7.8E-15 65 224
PF08241 Methyltransf_11 Methyltransferase domain 2.7E-13 74 166
PF08242 Methyltransf_12 Methyltransferase domain 1.3E-10 74 165
PF13847 Methyltransf_31 Methyltransferase domain 2.8E-10 71 172
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 5.1E-05 69 171

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.663 0.4624 0.0309 0.2008 0.0697 0.0213 0.3839 0.2329 0.2595 0.0117

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup205
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3666
Ophiocordyceps australis 1348a (Ghana) OphauG2|7647
Ophiocordyceps australis map64 (Brazil) OphauB2|6797
Ophiocordyceps australis map64 (Brazil) OphauB2|805
Ophiocordyceps camponoti-floridani Ophcf2|02847
Ophiocordyceps camponoti-floridani Ophcf2|02848
Ophiocordyceps camponoti-rufipedis Ophun1|744
Ophiocordyceps kimflemingae Ophio5|7186
Ophiocordyceps kimflemingae Ophio5|7187
Ophiocordyceps subramaniannii Hirsu2|11015
Ophiocordyceps subramaniannii Hirsu2|11016 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11016
MDPEDGTAPLDESLTETIELLGRTYQKYALVAGTYFAPIDEEEISRLELMHSVLCRVFDDRLIFPPVGAPNRVLD
CGCGAGDWAVDVARRFPECEVLGIDVSPHMIPEDPPNNLEIQIDDLNGRFTFPPDHFDVVHSQMMAGGIHANRWR
SYVQDIFRVLRPGGWCQMVEVYFNAQSDNGTLGRDDALSRWSSQYLNTLHPRKDPRAALQLPSWMRSAGFKEVES
RLLTLPMCAWPVEAEARQRDIGAANRENVAQLLHSLALYPFTQLRGMPLNEFDRLVDEARREASNPSFKAYFPL*
Coding >Hirsu2|11016
ATGGATCCAGAGGACGGAACGGCGCCTCTCGACGAATCCCTCACGGAAACCATCGAGTTGCTTGGTCGAACGTAC
CAGAAGTATGCTCTGGTGGCCGGCACGTACTTTGCACCAATCGACGAGGAGGAGATTTCGCGTCTGGAATTGATG
CACTCTGTGCTATGCAGAGTCTTCGACGACCGGCTCATCTTCCCTCCCGTGGGCGCGCCAAACAGGGTCCTGGAC
TGCGGCTGCGGAGCGGGAGACTGGGCCGTCGACGTCGCGAGACGATTCCCCGAGTGCGAGGTCCTAGGGATAGAC
GTCAGTCCTCACATGATCCCCGAGGATCCGCCCAACAATCTCGAAATCCAGATCGACGACCTGAATGGGAGATTT
ACCTTTCCGCCAGACCACTTCGACGTTGTACACAGCCAGATGATGGCTGGCGGGATTCACGCGAACCGATGGCGA
AGCTATGTGCAGGACATCTTCCGGGTGCTGCGGCCGGGCGGCTGGTGCCAGATGGTCGAAGTCTACTTCAACGCG
CAGTCGGACAACGGAACGCTTGGAAGAGATGATGCCTTGTCGCGGTGGTCGAGCCAATACCTCAACACGCTGCAT
CCACGGAAGGATCCCAGAGCGGCCCTGCAGCTTCCAAGCTGGATGAGGAGCGCCGGATTCAAGGAGGTCGAGTCC
AGGCTACTGACGCTGCCCATGTGCGCGTGGCCAGTTGAGGCAGAAGCCCGACAGCGCGATATCGGGGCCGCCAAC
CGCGAGAACGTGGCTCAGCTGCTTCACTCGCTGGCGCTGTATCCGTTCACCCAGCTGCGAGGCATGCCGTTGAAC
GAGTTCGACCGCCTCGTCGACGAAGCGAGGAGGGAGGCGAGCAATCCCTCATTCAAGGCATATTTCCCTCTGTGA
Transcript >Hirsu2|11016
ATGGATCCAGAGGACGGAACGGCGCCTCTCGACGAATCCCTCACGGAAACCATCGAGTTGCTTGGTCGAACGTAC
CAGAAGTATGCTCTGGTGGCCGGCACGTACTTTGCACCAATCGACGAGGAGGAGATTTCGCGTCTGGAATTGATG
CACTCTGTGCTATGCAGAGTCTTCGACGACCGGCTCATCTTCCCTCCCGTGGGCGCGCCAAACAGGGTCCTGGAC
TGCGGCTGCGGAGCGGGAGACTGGGCCGTCGACGTCGCGAGACGATTCCCCGAGTGCGAGGTCCTAGGGATAGAC
GTCAGTCCTCACATGATCCCCGAGGATCCGCCCAACAATCTCGAAATCCAGATCGACGACCTGAATGGGAGATTT
ACCTTTCCGCCAGACCACTTCGACGTTGTACACAGCCAGATGATGGCTGGCGGGATTCACGCGAACCGATGGCGA
AGCTATGTGCAGGACATCTTCCGGGTGCTGCGGCCGGGCGGCTGGTGCCAGATGGTCGAAGTCTACTTCAACGCG
CAGTCGGACAACGGAACGCTTGGAAGAGATGATGCCTTGTCGCGGTGGTCGAGCCAATACCTCAACACGCTGCAT
CCACGGAAGGATCCCAGAGCGGCCCTGCAGCTTCCAAGCTGGATGAGGAGCGCCGGATTCAAGGAGGTCGAGTCC
AGGCTACTGACGCTGCCCATGTGCGCGTGGCCAGTTGAGGCAGAAGCCCGACAGCGCGATATCGGGGCCGCCAAC
CGCGAGAACGTGGCTCAGCTGCTTCACTCGCTGGCGCTGTATCCGTTCACCCAGCTGCGAGGCATGCCGTTGAAC
GAGTTCGACCGCCTCGTCGACGAAGCGAGGAGGGAGGCGAGCAATCCCTCATTCAAGGCATATTTCCCTCTGTGA
Gene >Hirsu2|11016
ATGGATCCAGAGTCAGAATTTCACTCGTGGACGGAAGCGCGAGGAGCACGACTGACGGCCTCTGAAGGGACGGAA
CGGCGCCTCTCGACGAATCCCTCACGGAAACCATCGAGTTGCTTGGTCGAACGTACCAGAAGTATGCTCTGGTGG
CCGGCACGTACTTTGCACCAATCGACGAGGTAAGACAGGGGTCCTTTTCCACGGCCAGGGCAGGCTGAAAAAGCT
GGCTGCGGTATAGCTGACGAGACCGTGGACAGGAGGAGATTTCGCGTCTGGAATTGATGCACTCTGTGCTATGCA
GAGTCTTCGACGACCGGCTCATCTTCCCTCCCGTGGGCGCGCCAAACAGGGTCCTGGACTGCGGCTGCGGAGCGG
GAGACTGGGCCGTCGACGTCGCGAGACGATTCCCCGAGTGCGAGGTGCGTTTTCGATTTCGAACGCGGTTGTTCG
TGCCGACGCGACTGTGCACATGACCGCCAGACTGCATCGGCAGCTCCCGACTTCCACAGAAGCCGAAAAGGCGAA
GATACGGAGTTTCCTGCTTCGTGGCCAGGCGTGCCGGTTCGGGCCTTCAGGTCCTCCCCTCCCAGCATGTCGCGA
TGGCTATACTCTTTTCATCCCTCTCTTGTCCACCTGGTGGCGAGACTTGTCACCCCGGTGGCGAGGCTTGTCCCG
AGCGGATGTCGATGCACCAGACTGGTGTCTTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGTTTCGA
TCGTCCAAGCTAACGAGACTGGCCAGGTCCTAGGGATAGACGTCAGTCCTCACATGATCCCCGAGGATCCGCCCA
ACAATCTCGAAATCCAGATCGACGACCTGAATGGGAGGTTGGCAGTGCCACCAGAATGGCGCGTGCAGAAGAGGT
GCTAAGGGTACTGCGGCAGATTTACCTTTCCGCCAGACCACTTCGACGTTGTACACAGCCAGATGATGGCTGGCG
GGATTCACGCGAACCGATGGCGAAGCTATGTGCAGGACATCTTCCGGGTGCTGCGGCCGGGCGGCTGGTGCCAGA
TGGTCGAAGTCTACTTCAACGCGCAGTCGGACAACGGAACGCTTGGAAGAGGCAAGCAGCCCACAAGGTCCCGGA
TGTCTGACGAGGTCGGACGGGAGAGCGGCGGCTGTGCTGACCCGGGCCGAGGACGGATAGATGATGCCTTGTCGC
GGTGGTCGAGCCAATACCTCAACACGCTGCATCCACGGAAGGATCCCAGAGCGGCCCTGCAGCTTCCAAGCTGGA
TGAGGAGCGCCGGATTCAAGGAGGTCGAGTCCAGGCTACTGACGCTGCCCATGTGCGCGTGGCCAGTTGGTATTG
TTCCCCCCTACTCCCAGAGTGCCTGCAGGCATGGAGCCTAAGGAGAAAGGGGCCTGACCGGAAACCAAAACAAAC
GGATGAAAAGAGGCAGAAGCCCGACAGCGCGATATCGGGGCCGCCAACCGCGAGAACGTGGCTCAGCTGCTTCAC
TCGCTGGCGCTGTATCCGTTCACCCAGCTGCGAGGGTAAGAAGTCGGCGACCGTGGCGTGGTACGGGACTAAGGT
TTCGGCAGCATGCCGTTGAACGAGTTCGACCGCCTCGTCGACGAAGCGAGGAGGGAGGCGAGCAATCCCTCATTC
AAGGTGCGCGTTCCGGAGAGGAAGGCGAGGTGCTGGTCATTGGCGGCCGGTGCCTGTCGTCGATGCCGGCCACGG
GGTTGCGGGCGACAACGGCGCTGACGCTTTGACCGGTGGCAGGCATATTTCCCTCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail