Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11013
Gene name
LocationContig_946:434..1498
Strand+
Gene length (bp)1064
Transcript length (bp)990
Coding sequence length (bp)990
Protein length (aa) 330

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04143 Sulf_transp Sulphur transport 8.5E-31 20 322

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 81 103 22
2 108 130 22
3 161 178 17
4 188 207 19
5 243 265 22
6 275 297 22
7 304 326 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11013
MAEIALSGAVFGAAMTASGFHDPSIIAAQMRFQNWHMMQTFLAATASSALVYSAAERLGHVRLPSRCSSPLALFS
KYDGNVIGGLLLGTGIALSASCPGALYAQLAAGVPAAVYTLAGAVAAGVLWAGYLADLVQRRRRAMNATPEPCAV
HEQLRLSRPAALLLLVAACVALVALTASHGRPSPGANVVGAVGGLLIGLAQLVSLVARRSMIGVSASYEEAGTLF
WSLVAGFRRDPTPRPYRSLLFGLGVVAGAWGLLHAAPSFAVRPAFEARPLFAAAGGFAMALGASMAGGCTSGHGI
SGISLLSASSLVSIASTFAAGALVAALVH*
Coding >Hirsu2|11013
ATGGCCGAGATCGCCCTGTCCGGCGCCGTCTTCGGCGCCGCCATGACCGCCTCCGGCTTCCACGACCCTTCCATC
ATCGCCGCCCAGATGAGGTTTCAAAACTGGCACATGATGCAGACCTTTCTGGCAGCCACCGCCAGCAGCGCCCTC
GTCTACAGCGCCGCCGAGCGCCTCGGCCACGTCCGCCTCCCGTCCCGCTGCTCCTCCCCGCTCGCCCTCTTCTCC
AAGTACGACGGCAACGTCATCGGCGGCCTCCTGCTCGGCACCGGCATCGCCCTGTCCGCCTCGTGCCCCGGCGCC
CTGTACGCCCAGCTCGCCGCCGGCGTGCCGGCCGCCGTCTACACCCTCGCCGGCGCCGTCGCCGCCGGCGTCCTG
TGGGCCGGCTACCTCGCCGACCTCGTCCAGCGCCGCCGCCGCGCCATGAACGCCACGCCCGAGCCGTGCGCCGTC
CACGAGCAGCTCCGCCTCTCCAGGCCCGCCGCCCTGCTGCTCCTTGTCGCCGCCTGCGTCGCCCTCGTCGCCCTC
ACCGCCAGCCACGGCCGGCCGAGCCCCGGTGCCAACGTCGTCGGCGCCGTCGGCGGCCTGCTCATCGGCCTCGCC
CAGCTCGTCTCCCTCGTCGCGCGCCGCTCCATGATCGGCGTCTCCGCCTCGTACGAGGAGGCCGGCACCCTGTTC
TGGTCCCTCGTCGCCGGCTTCCGCCGCGACCCGACCCCTCGCCCCTACCGGAGCCTCCTCTTCGGTCTCGGCGTC
GTCGCCGGCGCCTGGGGCCTCCTCCACGCCGCCCCGTCCTTCGCCGTCCGCCCCGCCTTCGAGGCCCGCCCCCTG
TTCGCCGCCGCCGGCGGCTTCGCCATGGCTCTCGGCGCTAGCATGGCCGGCGGCTGCACCTCCGGCCATGGCATC
AGCGGCATCTCGCTGCTCTCCGCCTCCAGCCTCGTCAGCATTGCCAGCACCTTCGCCGCCGGAGCCTTGGTCGCC
GCCCTCGTCCATTGA
Transcript >Hirsu2|11013
ATGGCCGAGATCGCCCTGTCCGGCGCCGTCTTCGGCGCCGCCATGACCGCCTCCGGCTTCCACGACCCTTCCATC
ATCGCCGCCCAGATGAGGTTTCAAAACTGGCACATGATGCAGACCTTTCTGGCAGCCACCGCCAGCAGCGCCCTC
GTCTACAGCGCCGCCGAGCGCCTCGGCCACGTCCGCCTCCCGTCCCGCTGCTCCTCCCCGCTCGCCCTCTTCTCC
AAGTACGACGGCAACGTCATCGGCGGCCTCCTGCTCGGCACCGGCATCGCCCTGTCCGCCTCGTGCCCCGGCGCC
CTGTACGCCCAGCTCGCCGCCGGCGTGCCGGCCGCCGTCTACACCCTCGCCGGCGCCGTCGCCGCCGGCGTCCTG
TGGGCCGGCTACCTCGCCGACCTCGTCCAGCGCCGCCGCCGCGCCATGAACGCCACGCCCGAGCCGTGCGCCGTC
CACGAGCAGCTCCGCCTCTCCAGGCCCGCCGCCCTGCTGCTCCTTGTCGCCGCCTGCGTCGCCCTCGTCGCCCTC
ACCGCCAGCCACGGCCGGCCGAGCCCCGGTGCCAACGTCGTCGGCGCCGTCGGCGGCCTGCTCATCGGCCTCGCC
CAGCTCGTCTCCCTCGTCGCGCGCCGCTCCATGATCGGCGTCTCCGCCTCGTACGAGGAGGCCGGCACCCTGTTC
TGGTCCCTCGTCGCCGGCTTCCGCCGCGACCCGACCCCTCGCCCCTACCGGAGCCTCCTCTTCGGTCTCGGCGTC
GTCGCCGGCGCCTGGGGCCTCCTCCACGCCGCCCCGTCCTTCGCCGTCCGCCCCGCCTTCGAGGCCCGCCCCCTG
TTCGCCGCCGCCGGCGGCTTCGCCATGGCTCTCGGCGCTAGCATGGCCGGCGGCTGCACCTCCGGCCATGGCATC
AGCGGCATCTCGCTGCTCTCCGCCTCCAGCCTCGTCAGCATTGCCAGCACCTTCGCCGCCGGAGCCTTGGTCGCC
GCCCTCGTCCATTGA
Gene >Hirsu2|11013
ATGGCCGAGATCGCCCTGTCCGGCGCCGTCTTCGGCGCCGCCATGACCGCCTCCGGCTTCCACGACCCTTCCATC
ATCGCCGCCCAGATGAGGTTTCAAAACTGGCACATGATGCAGACCTTTCTGGCAGCCACCGCCAGCAGCGCGTCC
GTTTCTCCCTTTTTTTTTTTTTTTGCTTGGCACGTTGTAGCACGACATCAAATCGCTGACGCCGCGCCAGCCTCG
TCTACAGCGCCGCCGAGCGCCTCGGCCACGTCCGCCTCCCGTCCCGCTGCTCCTCCCCGCTCGCCCTCTTCTCCA
AGTACGACGGCAACGTCATCGGCGGCCTCCTGCTCGGCACCGGCATCGCCCTGTCCGCCTCGTGCCCCGGCGCCC
TGTACGCCCAGCTCGCCGCCGGCGTGCCGGCCGCCGTCTACACCCTCGCCGGCGCCGTCGCCGCCGGCGTCCTGT
GGGCCGGCTACCTCGCCGACCTCGTCCAGCGCCGCCGCCGCGCCATGAACGCCACGCCCGAGCCGTGCGCCGTCC
ACGAGCAGCTCCGCCTCTCCAGGCCCGCCGCCCTGCTGCTCCTTGTCGCCGCCTGCGTCGCCCTCGTCGCCCTCA
CCGCCAGCCACGGCCGGCCGAGCCCCGGTGCCAACGTCGTCGGCGCCGTCGGCGGCCTGCTCATCGGCCTCGCCC
AGCTCGTCTCCCTCGTCGCGCGCCGCTCCATGATCGGCGTCTCCGCCTCGTACGAGGAGGCCGGCACCCTGTTCT
GGTCCCTCGTCGCCGGCTTCCGCCGCGACCCGACCCCTCGCCCCTACCGGAGCCTCCTCTTCGGTCTCGGCGTCG
TCGCCGGCGCCTGGGGCCTCCTCCACGCCGCCCCGTCCTTCGCCGTCCGCCCCGCCTTCGAGGCCCGCCCCCTGT
TCGCCGCCGCCGGCGGCTTCGCCATGGCTCTCGGCGCTAGCATGGCCGGCGGCTGCACCTCCGGCCATGGCATCA
GCGGCATCTCGCTGCTCTCCGCCTCCAGCCTCGTCAGCATTGCCAGCACCTTCGCCGCCGGAGCCTTGGTCGCCG
CCCTCGTCCATTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail