Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10994
Gene name
LocationContig_941:82..1262
Strand-
Gene length (bp)1180
Transcript length (bp)1119
Coding sequence length (bp)1119
Protein length (aa) 373

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13540 RCC1_2 Regulator of chromosome condensation (RCC1) repeat 3.0E-07 331 360

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08023|FMP25_YEAST Protein FMP25, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP25 PE=4 SV=1 118 369 5.0E-20
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 122 363 2.0E-09
sp|P28745|RCC1_SCHPO Protein pim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pim1 PE=1 SV=2 91 362 3.0E-08
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 267 362 3.0E-07
sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 164 363 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08023|FMP25_YEAST Protein FMP25, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP25 PE=4 SV=1 118 369 5.0E-20
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 122 363 2.0E-09
sp|P28745|RCC1_SCHPO Protein pim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pim1 PE=1 SV=2 91 362 3.0E-08
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 267 362 3.0E-07
sp|Q9UII4|HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 164 363 2.0E-06
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 265 366 2.0E-06
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 90 363 2.0E-06
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 257 362 5.0E-06
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 122 363 5.0E-06
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 257 362 5.0E-06
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 265 362 6.0E-06
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 90 363 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 49 66 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10994
MNASQTALRRATRAGCSIPRCASAPPRQWARLASDSARQPAPGRRGGKAVGFAAVFAVAAAGAYYYSEFRGQAES
EPEKGGPAKAEFEFEKPRKRPVSKEDNRELISSQHLQVKSSWEHPGVYAWGSNAGKVIDPDSDDKYVKFPRRIAH
FNDQLLRGLKLTQYFGAAIAENGDLVQWGTGFSKTDPRPQTTLKGKDLVRLEVSEDRVIALSRGGVVYSIPSSRD
DQVNGVKRERETSAWSLWSSGGKEAVSFRTLTPTSLRRGERVTDISSGLEHCLMLTNKGRVFSAASSTTSFPSKG
QMGIPTLEWDRRPEGPYDQAHEIMDLRGFEVTQIATGDFHSVVLDKAGRLFSFGENIFGQLGSEVELAMPSM*
Coding >Hirsu2|10994
ATGAACGCGTCCCAGACAGCTCTTCGGCGAGCCACTCGGGCCGGCTGCTCTATCCCCAGATGTGCGTCGGCGCCT
CCGCGCCAGTGGGCTCGGCTGGCCAGCGACTCGGCGCGGCAGCCGGCCCCTGGTCGCCGAGGCGGCAAAGCCGTC
GGGTTCGCGGCCGTCTTCGCCGTCGCCGCGGCCGGCGCATACTACTATAGCGAGTTCCGGGGCCAGGCCGAGAGC
GAGCCGGAAAAGGGCGGGCCGGCCAAGGCCGAGTTCGAGTTCGAAAAGCCGAGGAAGCGGCCGGTGTCCAAGGAA
GATAACCGGGAGCTCATCAGCTCGCAGCACCTGCAGGTCAAGAGCAGCTGGGAACACCCGGGTGTCTACGCCTGG
GGCTCCAACGCCGGCAAGGTCATCGACCCGGACTCGGACGACAAGTACGTCAAGTTTCCGCGACGGATCGCCCAT
TTCAACGACCAGCTCCTGCGCGGGCTGAAGCTCACGCAGTACTTTGGGGCGGCCATCGCGGAAAACGGAGACCTG
GTGCAGTGGGGCACGGGCTTCTCCAAGACGGATCCGCGGCCGCAGACGACGCTCAAGGGCAAGGATCTCGTCAGG
CTGGAGGTGTCGGAGGACCGCGTCATCGCTCTGTCTCGCGGTGGCGTCGTCTACTCGATCCCATCGTCGCGCGAC
GACCAGGTGAACGGGGTGAAGAGGGAGCGGGAGACGAGCGCATGGTCGCTCTGGAGCTCGGGCGGCAAGGAGGCC
GTCAGCTTCCGGACGCTGACGCCGACCAGCCTGAGGCGGGGCGAGAGGGTGACGGACATCAGCAGCGGCCTGGAG
CACTGCCTCATGCTGACGAACAAGGGGCGCGTCTTCTCGGCGGCCTCGAGCACGACGTCGTTCCCGAGCAAGGGC
CAGATGGGGATCCCGACGCTCGAGTGGGACAGGAGGCCCGAGGGCCCCTACGACCAAGCACACGAAATCATGGAC
CTCCGGGGGTTCGAGGTGACGCAGATCGCCACGGGCGACTTCCACTCGGTGGTGCTGGACAAGGCCGGAAGGCTG
TTTTCCTTTGGCGAGAACATCTTCGGGCAGCTGGGGTCCGAGGTGGAGCTGGCGATGCCGTCCATGTGA
Transcript >Hirsu2|10994
ATGAACGCGTCCCAGACAGCTCTTCGGCGAGCCACTCGGGCCGGCTGCTCTATCCCCAGATGTGCGTCGGCGCCT
CCGCGCCAGTGGGCTCGGCTGGCCAGCGACTCGGCGCGGCAGCCGGCCCCTGGTCGCCGAGGCGGCAAAGCCGTC
GGGTTCGCGGCCGTCTTCGCCGTCGCCGCGGCCGGCGCATACTACTATAGCGAGTTCCGGGGCCAGGCCGAGAGC
GAGCCGGAAAAGGGCGGGCCGGCCAAGGCCGAGTTCGAGTTCGAAAAGCCGAGGAAGCGGCCGGTGTCCAAGGAA
GATAACCGGGAGCTCATCAGCTCGCAGCACCTGCAGGTCAAGAGCAGCTGGGAACACCCGGGTGTCTACGCCTGG
GGCTCCAACGCCGGCAAGGTCATCGACCCGGACTCGGACGACAAGTACGTCAAGTTTCCGCGACGGATCGCCCAT
TTCAACGACCAGCTCCTGCGCGGGCTGAAGCTCACGCAGTACTTTGGGGCGGCCATCGCGGAAAACGGAGACCTG
GTGCAGTGGGGCACGGGCTTCTCCAAGACGGATCCGCGGCCGCAGACGACGCTCAAGGGCAAGGATCTCGTCAGG
CTGGAGGTGTCGGAGGACCGCGTCATCGCTCTGTCTCGCGGTGGCGTCGTCTACTCGATCCCATCGTCGCGCGAC
GACCAGGTGAACGGGGTGAAGAGGGAGCGGGAGACGAGCGCATGGTCGCTCTGGAGCTCGGGCGGCAAGGAGGCC
GTCAGCTTCCGGACGCTGACGCCGACCAGCCTGAGGCGGGGCGAGAGGGTGACGGACATCAGCAGCGGCCTGGAG
CACTGCCTCATGCTGACGAACAAGGGGCGCGTCTTCTCGGCGGCCTCGAGCACGACGTCGTTCCCGAGCAAGGGC
CAGATGGGGATCCCGACGCTCGAGTGGGACAGGAGGCCCGAGGGCCCCTACGACCAAGCACACGAAATCATGGAC
CTCCGGGGGTTCGAGGTGACGCAGATCGCCACGGGCGACTTCCACTCGGTGGTGCTGGACAAGGCCGGAAGGCTG
TTTTCCTTTGGCGAGAACATCTTCGGGCAGCTGGGGTCCGAGGTGGAGCTGGCGATGCCGTCCATGTGA
Gene >Hirsu2|10994
ATGAACGCGTCCCAGACAGCTCTTCGGCGAGCCACTCGGGCCGGCTGCTCTATCCCCAGATGTGCGTCGGCGCCT
CCGCGCCAGTGGGCTCGGCTGGCCAGCGACTCGGCGCGGCAGCCGGCCCCTGGTCGCCGAGGCGGCAAAGCCGTC
GGGTTCGCGGCCGTCTTCGCCGTCGCCGCGGCCGGCGCATACTACTATAGCGAGTTCCGGGGCCAGGCCGAGAGC
GAGCCGGAAAAGGGCGGGCCGGCCAAGGCCGAGTTCGAGTTCGAAAAGCCGAGGAAGCGGCCGGTGTCCAAGGAA
GATAACCGGGAGCTCATCAGCTCGCAGCACCTGCAGGTCAAGAGCAGCTGGGAACACCCGGGTGTCTACGCCTGG
GGCTCCAACGCCGGCAAGGTCATCGACCCGGACTCGGACGACAAGTACGTCAAGTTTCCGCGACGGATCGCCCAT
TTCAACGACCAGCTCCTGCGCGGGCTGAAGCTCACGCAGTACTTTGGGGCGGCCATCGCGGAAAACGGAGACCTG
GTGCAGTGGGGCACGGGCTTCTCCAAGACGGATCCGCGGCCGCAGACGACGCTCAAGGGCAAGGATCTCGTCAGG
CTGGAGGTGTCGGAGGACCGCGTCATCGCTCTGTCTCGCGGTGGCGTCGTCTACTCGATCCCATCGTCGCGCGAC
GACCAGGTGAACGGGGTGAAGAGGGAGCGGGAGACGAGCGCATGGTCGCTCTGGAGCTCGGGCGGCAAGGAGGCC
GTCAGCTTCCGGACGCTGACGCCGACCAGCCTGAGGCGGGGCGAGAGGGTGACGGACATCAGCAGCGGCCTGGAG
CACTGCCTCATGCTGACGAACAAGGGGCGCGTCTTCTCGGCGGCCTCGAGCACGACGTCGTTCCCGAGCAAGGGC
CAGATGGGGATCCCGACGCTCGAGTGGGACAGGAGGCCCGAGGGCCCCTACGACCAAGCACACGAAATCATGGAC
CTCCGGGGGTTCGAGGTGACGCAGATCGCCACGGGCGACTTCCACTCGGTGGTGCTGGACAAGGCCGGAAGGCTG
TTTTCCTTTGGCGAGAACATCTTCGGGCAGCTGGGGTCCGAGGTGGAGCTGGCGATGCCGTCCATGTTCGCGCCG
ACGAGCGTGGCGGTCGACAGGCTGTACCGGGGCAGCGGGCTGACGGCCAAGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail