Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10990
Gene name
LocationContig_94:37490..38698
Strand-
Gene length (bp)1208
Transcript length (bp)1149
Coding sequence length (bp)1149
Protein length (aa) 383

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00291 PALP Pyridoxal-phosphate dependent enzyme 7.2E-53 32 356

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P13228|TRP_NEUCR Tryptophan synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trp-3 PE=1 SV=1 1 382 0.0E+00
sp|P00931|TRP_YEAST Tryptophan synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP5 PE=1 SV=1 3 382 0.0E+00
sp|O13831|TRP_SCHPO Tryptophan synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trp2 PE=2 SV=1 3 382 0.0E+00
sp|A8NEP3|TRP_COPC7 Tryptophan synthase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=TRP-1 PE=3 SV=2 1 378 0.0E+00
sp|P16578|TRP_COPCI Tryptophan synthase OS=Coprinopsis cinerea GN=TRP-1 PE=3 SV=3 1 378 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P13228|TRP_NEUCR Tryptophan synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trp-3 PE=1 SV=1 1 382 0.0E+00
sp|P00931|TRP_YEAST Tryptophan synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP5 PE=1 SV=1 3 382 0.0E+00
sp|O13831|TRP_SCHPO Tryptophan synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trp2 PE=2 SV=1 3 382 0.0E+00
sp|A8NEP3|TRP_COPC7 Tryptophan synthase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=TRP-1 PE=3 SV=2 1 378 0.0E+00
sp|P16578|TRP_COPCI Tryptophan synthase OS=Coprinopsis cinerea GN=TRP-1 PE=3 SV=3 1 378 0.0E+00
sp|Q8R9M9|TRPB_CALS4 Tryptophan synthase beta chain OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=trpB PE=3 SV=1 1 366 3.0E-170
sp|B0K8T6|TRPB_THEP3 Tryptophan synthase beta chain OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=trpB PE=3 SV=1 1 369 5.0E-170
sp|B1YLS4|TRPB_EXIS2 Tryptophan synthase beta chain OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=trpB PE=3 SV=1 1 369 4.0E-169
sp|B2V8W5|TRPB_SULSY Tryptophan synthase beta chain OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=trpB PE=3 SV=1 1 369 5.0E-169
sp|Q8ESU4|TRPB_OCEIH Tryptophan synthase beta chain OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=trpB PE=3 SV=1 1 369 4.0E-168
sp|B0K2T9|TRPB_THEPX Tryptophan synthase beta chain OS=Thermoanaerobacter sp. (strain X514) GN=trpB PE=3 SV=1 1 369 5.0E-168
sp|O66923|TRPB1_AQUAE Tryptophan synthase beta chain 1 OS=Aquifex aeolicus (strain VF5) GN=trpB1 PE=3 SV=1 1 369 7.0E-168
sp|C1ELF0|TRPB_BACC3 Tryptophan synthase beta chain OS=Bacillus cereus (strain 03BB102) GN=trpB PE=3 SV=1 1 372 2.0E-167
sp|A0RB64|TRPB_BACAH Tryptophan synthase beta chain OS=Bacillus thuringiensis (strain Al Hakam) GN=trpB PE=3 SV=1 1 372 2.0E-167
sp|A5N7P0|TRPB_CLOK5 Tryptophan synthase beta chain OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=trpB PE=3 SV=1 1 367 1.0E-166
sp|B9E151|TRPB_CLOK1 Tryptophan synthase beta chain OS=Clostridium kluyveri (strain NBRC 12016) GN=trpB PE=3 SV=1 1 367 1.0E-166
sp|Q97EF5|TRPB_CLOAB Tryptophan synthase beta chain OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=trpB PE=3 SV=1 1 369 2.0E-166
sp|Q6HLU4|TRPB_BACHK Tryptophan synthase beta chain OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=trpB PE=3 SV=1 1 372 3.0E-166
sp|Q81TL8|TRPB_BACAN Tryptophan synthase beta chain OS=Bacillus anthracis GN=trpB PE=1 SV=1 1 372 3.0E-166
sp|C3LAV8|TRPB_BACAC Tryptophan synthase beta chain OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=trpB PE=3 SV=1 1 372 3.0E-166
sp|C3P3U0|TRPB_BACAA Tryptophan synthase beta chain OS=Bacillus anthracis (strain A0248) GN=trpB PE=3 SV=1 1 372 3.0E-166
sp|B7HH01|TRPB_BACC4 Tryptophan synthase beta chain OS=Bacillus cereus (strain B4264) GN=trpB PE=3 SV=1 1 372 5.0E-166
sp|B7I0F2|TRPB_BACC7 Tryptophan synthase beta chain OS=Bacillus cereus (strain AH187) GN=trpB PE=3 SV=1 1 372 5.0E-166
sp|A9VJW2|TRPB_BACWK Tryptophan synthase beta chain OS=Bacillus weihenstephanensis (strain KBAB4) GN=trpB PE=3 SV=1 1 372 8.0E-166
sp|Q81GG5|TRPB_BACCR Tryptophan synthase beta chain OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=trpB PE=3 SV=1 1 372 1.0E-165
sp|B7IM76|TRPB_BACC2 Tryptophan synthase beta chain OS=Bacillus cereus (strain G9842) GN=trpB PE=3 SV=1 1 372 1.0E-165
sp|B9IU38|TRPB_BACCQ Tryptophan synthase beta chain OS=Bacillus cereus (strain Q1) GN=trpB PE=3 SV=1 1 372 3.0E-165
sp|Q63EC7|TRPB_BACCZ Tryptophan synthase beta chain OS=Bacillus cereus (strain ZK / E33L) GN=trpB PE=3 SV=1 1 372 4.0E-165
sp|Q02YB7|TRPB_LACLS Tryptophan synthase beta chain OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=trpB PE=3 SV=1 1 369 5.0E-165
sp|Q8Y6Q6|TRPB_LISMO Tryptophan synthase beta chain OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trpB PE=3 SV=1 1 369 5.0E-165
sp|B8DHB4|TRPB_LISMH Tryptophan synthase beta chain OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=trpB PE=3 SV=1 1 369 6.0E-165
sp|Q73BQ7|TRPB_BACC1 Tryptophan synthase beta chain OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=trpB PE=3 SV=1 1 372 8.0E-165
sp|Q71Z40|TRPB_LISMF Tryptophan synthase beta chain OS=Listeria monocytogenes serotype 4b (strain F2365) GN=trpB PE=3 SV=1 1 369 8.0E-165
sp|C1KVS5|TRPB_LISMC Tryptophan synthase beta chain OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=trpB PE=3 SV=1 1 369 8.0E-165
sp|A2RK24|TRPB_LACLM Tryptophan synthase beta chain OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=trpB PE=3 SV=1 1 369 9.0E-165
sp|B2ISS1|TRPB_STRPS Tryptophan synthase beta chain OS=Streptococcus pneumoniae (strain CGSP14) GN=trpB PE=3 SV=1 1 369 1.0E-164
sp|B8ZN59|TRPB_STRPJ Tryptophan synthase beta chain OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=trpB PE=3 SV=1 1 369 1.0E-164
sp|B1I7S7|TRPB_STRPI Tryptophan synthase beta chain OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=trpB PE=3 SV=1 1 369 1.0E-164
sp|C1CMD3|TRPB_STRZP Tryptophan synthase beta chain OS=Streptococcus pneumoniae (strain P1031) GN=trpB PE=3 SV=1 1 369 1.0E-164
sp|C1CT51|TRPB_STRZT Tryptophan synthase beta chain OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=trpB PE=3 SV=1 1 369 2.0E-164
sp|Q97P32|TRPB_STRPN Tryptophan synthase beta chain OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=trpB PE=3 SV=1 1 369 2.0E-164
sp|C1C966|TRPB_STRP7 Tryptophan synthase beta chain OS=Streptococcus pneumoniae (strain 70585) GN=trpB PE=3 SV=1 1 369 2.0E-164
sp|B5E7M3|TRPB_STRP4 Tryptophan synthase beta chain OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=trpB PE=3 SV=1 1 369 3.0E-164
sp|Q604P3|TRPB_METCA Tryptophan synthase beta chain OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=trpB PE=3 SV=1 1 366 4.0E-164
sp|Q8XXY0|TRPB_RALSO Tryptophan synthase beta chain OS=Ralstonia solanacearum (strain GMI1000) GN=trpB PE=3 SV=1 4 367 7.0E-164
sp|Q01998|TRPB_LACLA Tryptophan synthase beta chain OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpB PE=3 SV=1 1 369 1.0E-163
sp|B4RCL0|TRPB_PHEZH Tryptophan synthase beta chain OS=Phenylobacterium zucineum (strain HLK1) GN=trpB PE=3 SV=1 1 369 2.0E-163
sp|A0AJ80|TRPB_LISW6 Tryptophan synthase beta chain OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=trpB PE=3 SV=1 1 369 2.0E-163
sp|C1CG42|TRPB_STRZJ Tryptophan synthase beta chain OS=Streptococcus pneumoniae (strain JJA) GN=trpB PE=3 SV=1 1 369 2.0E-163
sp|Q89WE5|TRPB_BRADU Tryptophan synthase beta chain OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=trpB PE=3 SV=1 1 369 4.0E-163
sp|A5IBF7|TRPB_LEGPC Tryptophan synthase beta chain OS=Legionella pneumophila (strain Corby) GN=trpB PE=3 SV=1 1 366 5.0E-163
sp|Q5WX32|TRPB_LEGPL Tryptophan synthase beta chain OS=Legionella pneumophila (strain Lens) GN=trpB PE=3 SV=1 3 366 6.0E-163
sp|Q5X5Q2|TRPB_LEGPA Tryptophan synthase beta chain OS=Legionella pneumophila (strain Paris) GN=trpB PE=3 SV=1 3 366 6.0E-163
sp|Q8DNM8|TRPB_STRR6 Tryptophan synthase beta chain OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=trpB PE=3 SV=1 1 369 9.0E-163
sp|Q04IY9|TRPB_STRP2 Tryptophan synthase beta chain OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=trpB PE=3 SV=1 1 369 9.0E-163
sp|Q92B81|TRPB_LISIN Tryptophan synthase beta chain OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trpB PE=3 SV=1 1 369 1.0E-162
sp|A6TM76|TRPB_ALKMQ Tryptophan synthase beta chain OS=Alkaliphilus metalliredigens (strain QYMF) GN=trpB PE=3 SV=1 1 369 1.0E-162
sp|Q5ZVY4|TRPB_LEGPH Tryptophan synthase beta chain OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=trpB PE=3 SV=1 3 366 2.0E-162
sp|P16706|TRPB_ACICA Tryptophan synthase beta chain OS=Acinetobacter calcoaceticus GN=trpB PE=3 SV=2 1 366 4.0E-162
sp|Q6FEF1|TRPB_ACIAD Tryptophan synthase beta chain OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=trpB PE=3 SV=1 1 366 4.0E-162
sp|A6WX28|TRPB_OCHA4 Tryptophan synthase beta chain OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=trpB PE=3 SV=1 1 369 7.0E-162
sp|Q88B61|TRPB_PSESM Tryptophan synthase beta chain OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=trpB PE=3 SV=1 1 369 6.0E-161
sp|P07345|TRPB_PSEAE Tryptophan synthase beta chain OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trpB PE=3 SV=2 1 365 1.0E-160
sp|B1J4B1|TRPB_PSEPW Tryptophan synthase beta chain OS=Pseudomonas putida (strain W619) GN=trpB PE=3 SV=1 1 369 2.0E-160
sp|P12290|TRPB_CAUCR Tryptophan synthase beta chain OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=trpB PE=3 SV=1 1 369 2.0E-160
sp|Q1H0M1|TRPB_METFK Tryptophan synthase beta chain OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=trpB PE=3 SV=1 1 366 5.0E-160
sp|Q500R4|TRPB_PSEU2 Tryptophan synthase beta chain OS=Pseudomonas syringae pv. syringae (strain B728a) GN=trpB PE=3 SV=1 1 369 5.0E-160
sp|Q3MBV3|TRPB_ANAVT Tryptophan synthase beta chain OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=trpB PE=3 SV=1 1 369 6.0E-160
sp|Q7NGX9|TRPB_GLOVI Tryptophan synthase beta chain OS=Gloeobacter violaceus (strain PCC 7421) GN=trpB PE=3 SV=1 1 366 7.0E-160
sp|Q1IH20|TRPB_PSEE4 Tryptophan synthase beta chain OS=Pseudomonas entomophila (strain L48) GN=trpB PE=3 SV=1 1 369 1.0E-159
sp|B1XY48|TRPB_LEPCP Tryptophan synthase beta chain OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=trpB PE=3 SV=1 4 367 1.0E-159
sp|A1VRR7|TRPB_POLNA Tryptophan synthase beta chain OS=Polaromonas naphthalenivorans (strain CJ2) GN=trpB PE=3 SV=1 3 367 2.0E-159
sp|A7HPD3|TRPB_PARL1 Tryptophan synthase beta chain OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=trpB PE=3 SV=1 29 369 2.0E-159
sp|Q21CB9|TRPB_RHOPB Tryptophan synthase beta chain OS=Rhodopseudomonas palustris (strain BisB18) GN=trpB PE=3 SV=1 1 369 2.0E-159
sp|Q3AW11|TRPB_SYNS9 Tryptophan synthase beta chain OS=Synechococcus sp. (strain CC9902) GN=trpB PE=3 SV=1 1 369 3.0E-159
sp|A5E8A4|TRPB_BRASB Tryptophan synthase beta chain OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=trpB PE=3 SV=1 1 371 3.0E-159
sp|Q8DVF3|TRPB_STRMU Tryptophan synthase beta chain OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=trpB PE=3 SV=1 1 371 3.0E-159
sp|B6JCP2|TRPB_OLICO Tryptophan synthase beta chain OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=trpB PE=3 SV=1 1 369 6.0E-159
sp|Q8YQM6|TRPB2_NOSS1 Tryptophan synthase beta chain 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trpB2 PE=3 SV=1 1 369 6.0E-159
sp|Q48QG6|TRPB_PSE14 Tryptophan synthase beta chain OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=trpB PE=3 SV=1 1 369 9.0E-159
sp|Q3SHL9|TRPB_THIDA Tryptophan synthase beta chain OS=Thiobacillus denitrificans (strain ATCC 25259) GN=trpB PE=3 SV=1 1 366 1.0E-158
sp|Q5F9W3|TRPB_NEIG1 Tryptophan synthase beta chain OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=trpB PE=3 SV=1 1 366 1.0E-158
sp|Q849P2|TRPB_PSESH Tryptophan synthase beta chain OS=Pseudomonas savastanoi pv. phaseolicola GN=trpB PE=3 SV=1 1 369 1.0E-158
sp|Q0I6V1|TRPB_SYNS3 Tryptophan synthase beta chain OS=Synechococcus sp. (strain CC9311) GN=trpB PE=3 SV=1 16 369 2.0E-158
sp|Q8FXY4|TRPB_BRUSU Tryptophan synthase beta chain OS=Brucella suis biovar 1 (strain 1330) GN=trpB PE=3 SV=1 1 369 2.0E-158
sp|A9M9U2|TRPB_BRUC2 Tryptophan synthase beta chain OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=trpB PE=3 SV=1 1 369 2.0E-158
sp|Q7NUD8|TRPB_CHRVO Tryptophan synthase beta chain OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=trpB PE=3 SV=1 1 366 2.0E-158
sp|Q4KKP4|TRPB_PSEF5 Tryptophan synthase beta chain OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=trpB PE=3 SV=1 1 365 2.0E-158
sp|Q88RP6|TRPB_PSEPK Tryptophan synthase beta chain OS=Pseudomonas putida (strain KT2440) GN=trpB PE=3 SV=1 1 369 2.0E-158
sp|A5VWL3|TRPB_PSEP1 Tryptophan synthase beta chain OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=trpB PE=3 SV=1 1 369 2.0E-158
sp|P11080|TRPB_PSEPU Tryptophan synthase beta chain OS=Pseudomonas putida GN=trpB PE=3 SV=1 1 369 2.0E-158
sp|Q9K0B5|TRPB_NEIMB Tryptophan synthase beta chain OS=Neisseria meningitidis serogroup B (strain MC58) GN=trpB PE=3 SV=1 1 366 2.0E-158
sp|A1KSW2|TRPB_NEIMF Tryptophan synthase beta chain OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=trpB PE=3 SV=1 1 366 2.0E-158
sp|Q9JVC0|TRPB_NEIMA Tryptophan synthase beta chain OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=trpB PE=3 SV=1 1 366 2.0E-158
sp|B4RJV8|TRPB_NEIG2 Tryptophan synthase beta chain OS=Neisseria gonorrhoeae (strain NCCP11945) GN=trpB PE=3 SV=1 1 366 2.0E-158
sp|A4YJI6|TRPB_BRASO Tryptophan synthase beta chain OS=Bradyrhizobium sp. (strain ORS278) GN=trpB PE=3 SV=1 1 371 2.0E-158
sp|A9M354|TRPB_NEIM0 Tryptophan synthase beta chain OS=Neisseria meningitidis serogroup C (strain 053442) GN=trpB PE=3 SV=1 1 366 2.0E-158
sp|A2BNV9|TRPB_PROMS Tryptophan synthase beta chain OS=Prochlorococcus marinus (strain AS9601) GN=trpB PE=3 SV=1 1 369 3.0E-158
sp|Q3AGY2|TRPB_SYNSC Tryptophan synthase beta chain OS=Synechococcus sp. (strain CC9605) GN=trpB PE=3 SV=1 17 369 3.0E-158
sp|B0UIA8|TRPB_METS4 Tryptophan synthase beta chain OS=Methylobacterium sp. (strain 4-46) GN=trpB PE=3 SV=1 1 369 4.0E-158
sp|B0KFW3|TRPB_PSEPG Tryptophan synthase beta chain OS=Pseudomonas putida (strain GB-1) GN=trpB PE=3 SV=1 1 369 4.0E-158
sp|B9JG43|TRPB_AGRRK Tryptophan synthase beta chain OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=trpB PE=3 SV=1 1 369 4.0E-158
sp|Q03JC1|TRPB_STRTD Tryptophan synthase beta chain OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=trpB PE=3 SV=1 1 369 5.0E-158
sp|Q118P8|TRPB_TRIEI Tryptophan synthase beta chain OS=Trichodesmium erythraeum (strain IMS101) GN=trpB PE=3 SV=1 1 369 6.0E-158
sp|Q8YE60|TRPB_BRUME Tryptophan synthase beta chain OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=trpB PE=3 SV=2 1 369 7.0E-158
sp|C0RFZ4|TRPB_BRUMB Tryptophan synthase beta chain OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=trpB PE=3 SV=1 1 369 7.0E-158
sp|A2SHS4|TRPB_METPP Tryptophan synthase beta chain OS=Methylibium petroleiphilum (strain PM1) GN=trpB PE=3 SV=1 1 367 8.0E-158
sp|B1LSI6|TRPB_METRJ Tryptophan synthase beta chain OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=trpB PE=3 SV=1 1 367 9.0E-158
sp|Q11KK9|TRPB_CHESB Tryptophan synthase beta chain OS=Chelativorans sp. (strain BNC1) GN=trpB PE=3 SV=1 1 369 1.0E-157
sp|P19868|TRPB_GEOSE Tryptophan synthase beta chain OS=Geobacillus stearothermophilus GN=trpB PE=3 SV=1 1 369 1.0E-157
sp|Q0AGX5|TRPB_NITEC Tryptophan synthase beta chain OS=Nitrosomonas eutropha (strain C91) GN=trpB PE=3 SV=1 1 368 1.0E-157
sp|Q57AF0|TRPB_BRUAB Tryptophan synthase beta chain OS=Brucella abortus biovar 1 (strain 9-941) GN=trpB PE=3 SV=1 1 369 2.0E-157
sp|Q2YQW5|TRPB_BRUA2 Tryptophan synthase beta chain OS=Brucella abortus (strain 2308) GN=trpB PE=3 SV=1 1 369 2.0E-157
sp|B2S9A5|TRPB_BRUA1 Tryptophan synthase beta chain OS=Brucella abortus (strain S19) GN=trpB PE=3 SV=1 1 369 2.0E-157
sp|Q8YZP7|TRPB1_NOSS1 Tryptophan synthase beta chain 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trpB1 PE=3 SV=1 1 369 2.0E-157
sp|B0CJK8|TRPB_BRUSI Tryptophan synthase beta chain OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=trpB PE=3 SV=1 1 369 2.0E-157
sp|B3PVV2|TRPB_RHIE6 Tryptophan synthase beta chain OS=Rhizobium etli (strain CIAT 652) GN=trpB PE=3 SV=1 1 365 3.0E-157
sp|B5EK18|TRPB_ACIF5 Tryptophan synthase beta chain OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=trpB PE=3 SV=1 1 366 4.0E-157
sp|B7J4S9|TRPB_ACIF2 Tryptophan synthase beta chain OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=trpB PE=3 SV=1 1 366 4.0E-157
sp|B8I9V8|TRPB_METNO Tryptophan synthase beta chain OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=trpB PE=3 SV=1 1 369 4.0E-157
sp|A8FEJ8|TRPB_BACP2 Tryptophan synthase beta chain OS=Bacillus pumilus (strain SAFR-032) GN=trpB PE=3 SV=1 1 373 4.0E-157
sp|Q2KE82|TRPB_RHIEC Tryptophan synthase beta chain OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=trpB PE=1 SV=1 1 365 9.0E-157
sp|Q7TUL2|TRPB_PROMM Tryptophan synthase beta chain OS=Prochlorococcus marinus (strain MIT 9313) GN=trpB PE=3 SV=1 16 369 1.0E-156
sp|Q1MND6|TRPB_RHIL3 Tryptophan synthase beta chain OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=trpB PE=3 SV=1 1 365 1.0E-156
sp|B7L1H4|TRPB_METC4 Tryptophan synthase beta chain OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=trpB PE=3 SV=1 1 366 1.0E-156
sp|Q5M350|TRPB_STRT2 Tryptophan synthase beta chain OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=trpB PE=3 SV=1 1 369 1.0E-156
sp|B7GHQ9|TRPB_ANOFW Tryptophan synthase beta chain OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=trpB PE=3 SV=1 1 369 1.0E-156
sp|Q7TUH0|TRPB_PROMP Tryptophan synthase beta chain OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=trpB PE=3 SV=1 1 369 1.0E-156
sp|B1W0P0|TRPB_STRGG Tryptophan synthase beta chain OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=trpB PE=3 SV=1 11 366 1.0E-156
sp|Q3KK59|TRPB_PSEPF Tryptophan synthase beta chain OS=Pseudomonas fluorescens (strain Pf0-1) GN=trpB PE=3 SV=1 1 365 2.0E-156
sp|A0PYH3|TRPB_CLONN Tryptophan synthase beta chain OS=Clostridium novyi (strain NT) GN=trpB PE=3 SV=1 4 371 2.0E-156
sp|C1DH66|TRPB_AZOVD Tryptophan synthase beta chain OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=trpB PE=3 SV=1 1 365 2.0E-156
sp|P34817|TRPB_PSESY Tryptophan synthase beta chain OS=Pseudomonas syringae pv. syringae GN=trpB PE=3 SV=1 1 365 2.0E-156
sp|Q31D17|TRPB_PROM9 Tryptophan synthase beta chain OS=Prochlorococcus marinus (strain MIT 9312) GN=trpB PE=3 SV=1 1 369 3.0E-156
sp|Q82WI2|TRPB_NITEU Tryptophan synthase beta chain OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=trpB PE=3 SV=1 1 368 3.0E-156
sp|B5ZV70|TRPB_RHILW Tryptophan synthase beta chain OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=trpB PE=3 SV=1 1 365 4.0E-156
sp|Q5LYI7|TRPB_STRT1 Tryptophan synthase beta chain OS=Streptococcus thermophilus (strain CNRZ 1066) GN=trpB PE=3 SV=1 1 369 6.0E-156
sp|Q5LV94|TRPB_RUEPO Tryptophan synthase beta chain OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=trpB PE=3 SV=1 1 369 6.0E-156
sp|A5GP60|TRPB_SYNPW Tryptophan synthase beta chain OS=Synechococcus sp. (strain WH7803) GN=trpB PE=3 SV=1 16 369 9.0E-156
sp|P14671|TRPB1_ARATH Tryptophan synthase beta chain 1, chloroplastic OS=Arabidopsis thaliana GN=TSB1 PE=2 SV=1 1 369 1.0E-155
sp|Q21XI6|TRPB_RHOFT Tryptophan synthase beta chain OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=trpB PE=3 SV=1 4 367 1.0E-155
sp|A2BUE1|TRPB_PROM5 Tryptophan synthase beta chain OS=Prochlorococcus marinus (strain MIT 9515) GN=trpB PE=3 SV=1 1 369 2.0E-155
sp|A1B8L3|TRPB_PARDP Tryptophan synthase beta chain OS=Paracoccus denitrificans (strain Pd 1222) GN=trpB PE=3 SV=1 1 381 2.0E-155
sp|A4IQ82|TRPB_GEOTN Tryptophan synthase beta chain OS=Geobacillus thermodenitrificans (strain NG80-2) GN=trpB PE=3 SV=1 1 369 2.0E-155
sp|A1AXS9|TRPB_RUTMC Tryptophan synthase beta chain OS=Ruthia magnifica subsp. Calyptogena magnifica GN=trpB PE=3 SV=1 1 366 2.0E-155
sp|Q82A82|TRPB_STRAW Tryptophan synthase beta chain OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=trpB PE=3 SV=1 11 366 2.0E-155
sp|Q2G8S7|TRPB_NOVAD Tryptophan synthase beta chain OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=trpB PE=3 SV=1 1 369 2.0E-155
sp|B1ZG57|TRPB_METPB Tryptophan synthase beta chain OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=trpB PE=3 SV=1 1 366 2.0E-155
sp|B2FNZ1|TRPB_STRMK Tryptophan synthase beta chain OS=Stenotrophomonas maltophilia (strain K279a) GN=trpB PE=3 SV=1 4 366 3.0E-155
sp|O05625|TRPB_STRCO Tryptophan synthase beta chain OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpB PE=3 SV=2 11 366 3.0E-155
sp|A3PAN2|TRPB_PROM0 Tryptophan synthase beta chain OS=Prochlorococcus marinus (strain MIT 9301) GN=trpB PE=3 SV=1 1 369 4.0E-155
sp|A1TLG8|TRPB_ACIAC Tryptophan synthase beta chain OS=Acidovorax citrulli (strain AAC00-1) GN=trpB PE=3 SV=1 3 367 4.0E-155
sp|Q7TTS6|TRPB_SYNPX Tryptophan synthase beta chain OS=Synechococcus sp. (strain WH8102) GN=trpB PE=3 SV=1 17 369 4.0E-155
sp|Q126M1|TRPB_POLSJ Tryptophan synthase beta chain OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=trpB PE=3 SV=1 3 367 4.0E-155
sp|B4SQU8|TRPB_STRM5 Tryptophan synthase beta chain OS=Stenotrophomonas maltophilia (strain R551-3) GN=trpB PE=3 SV=1 4 366 5.0E-155
sp|A6UEI1|TRPB_SINMW Tryptophan synthase beta chain OS=Sinorhizobium medicae (strain WSM419) GN=trpB PE=3 SV=1 1 369 6.0E-155
sp|Q60179|TRPB_METJA Tryptophan synthase beta chain OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trpB PE=3 SV=1 1 369 6.0E-155
sp|Q84GJ9|TRPB_NEIGO Tryptophan synthase beta chain OS=Neisseria gonorrhoeae GN=trpB PE=3 SV=1 3 366 1.0E-154
sp|Q7UKG9|TRPB_RHOBA Tryptophan synthase beta chain OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=trpB PE=3 SV=1 4 366 2.0E-154
sp|Q59992|TRPB_SYNY3 Tryptophan synthase beta chain OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trpB PE=3 SV=1 1 369 2.0E-154
sp|Q47HQ5|TRPB_DECAR Tryptophan synthase beta chain OS=Dechloromonas aromatica (strain RCB) GN=trpB PE=3 SV=1 24 368 2.0E-154
sp|A5CRV6|TRPB_CLAM3 Tryptophan synthase beta chain OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=trpB PE=3 SV=1 3 364 3.0E-154
sp|Q7VE26|TRPB_PROMA Tryptophan synthase beta chain OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=trpB PE=3 SV=1 1 369 3.0E-154
sp|Q98CN7|TRPB_RHILO Tryptophan synthase beta chain OS=Rhizobium loti (strain MAFF303099) GN=trpB PE=3 SV=1 1 369 3.0E-154
sp|Q9X4E5|TRPB_RHOS4 Tryptophan synthase beta chain OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=trpB PE=3 SV=1 1 382 4.0E-154
sp|A8G2H0|TRPB_PROM2 Tryptophan synthase beta chain OS=Prochlorococcus marinus (strain MIT 9215) GN=trpB PE=3 SV=1 1 369 5.0E-154
sp|Q8U093|TRPB1_PYRFU Tryptophan synthase beta chain 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=trpB1 PE=1 SV=1 1 365 5.0E-154
sp|O28672|TRPB1_ARCFU Tryptophan synthase beta chain 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=trpB1 PE=3 SV=1 4 369 5.0E-154
sp|A9BD24|TRPB_PROM4 Tryptophan synthase beta chain OS=Prochlorococcus marinus (strain MIT 9211) GN=trpB PE=3 SV=1 1 369 6.0E-154
sp|A6LU96|TRPB_CLOB8 Tryptophan synthase beta chain OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=trpB PE=3 SV=1 1 365 7.0E-154
sp|P25269|TRBP2_ARATH Tryptophan synthase beta chain 2, chloroplastic OS=Arabidopsis thaliana GN=TSB2 PE=1 SV=2 1 364 2.0E-153
sp|B0REU1|TRPB_CLAMS Tryptophan synthase beta chain OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=trpB PE=3 SV=1 3 364 2.0E-153
sp|Q13EQ2|TRPB_RHOPS Tryptophan synthase beta chain OS=Rhodopseudomonas palustris (strain BisB5) GN=trpB PE=3 SV=1 1 369 3.0E-153
sp|C3MB99|TRPB_RHISN Tryptophan synthase beta chain OS=Rhizobium sp. (strain NGR234) GN=trpB PE=3 SV=1 1 365 4.0E-153
sp|Q8UJB0|TRPB_AGRFC Tryptophan synthase beta chain OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=trpB PE=3 SV=2 1 369 4.0E-153
sp|Q46HK9|TRPB_PROMT Tryptophan synthase beta chain OS=Prochlorococcus marinus (strain NATL2A) GN=trpB PE=3 SV=1 1 369 6.0E-153
sp|A2BZZ2|TRPB_PROM1 Tryptophan synthase beta chain OS=Prochlorococcus marinus (strain NATL1A) GN=trpB PE=3 SV=1 1 369 7.0E-153
sp|Q9V1G8|TRPB1_PYRAB Tryptophan synthase beta chain 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=trpB1 PE=3 SV=1 1 365 1.0E-152
sp|Q92TC9|TRPB_RHIME Tryptophan synthase beta chain OS=Rhizobium meliloti (strain 1021) GN=trpB PE=3 SV=1 1 365 1.0E-152
sp|A6UW25|TRPB_META3 Tryptophan synthase beta chain OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=trpB PE=3 SV=1 1 367 1.0E-152
sp|Q2J2G4|TRPB_RHOP2 Tryptophan synthase beta chain OS=Rhodopseudomonas palustris (strain HaA2) GN=trpB PE=3 SV=1 1 369 1.0E-152
sp|Q65I35|TRPB_BACLD Tryptophan synthase beta chain OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=trpB PE=3 SV=1 1 365 2.0E-152
sp|Q1GK77|TRPB_RUEST Tryptophan synthase beta chain OS=Ruegeria sp. (strain TM1040) GN=trpB PE=3 SV=1 1 380 2.0E-152
sp|B3Q605|TRPB_RHOPT Tryptophan synthase beta chain OS=Rhodopseudomonas palustris (strain TIE-1) GN=trpB PE=3 SV=1 1 369 2.0E-152
sp|Q6NDN6|TRPB_RHOPA Tryptophan synthase beta chain OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=trpB PE=3 SV=1 1 369 2.0E-152
sp|Q9KCB0|TRPB_BACHD Tryptophan synthase beta chain OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=trpB PE=3 SV=1 1 365 2.0E-152
sp|P07600|TRPB_BACSU Tryptophan synthase beta chain OS=Bacillus subtilis (strain 168) GN=trpB PE=3 SV=2 1 369 2.0E-152
sp|Q8DG49|TRPB_THEEB Tryptophan synthase beta chain OS=Thermosynechococcus elongatus (strain BP-1) GN=trpB PE=3 SV=1 1 365 3.0E-152
sp|A1WSF1|TRPB_VEREI Tryptophan synthase beta chain OS=Verminephrobacter eiseniae (strain EF01-2) GN=trpB PE=3 SV=1 4 367 4.0E-152
sp|P16609|TRPB_THET2 Tryptophan synthase beta chain OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=trpB PE=1 SV=1 1 365 1.0E-151
sp|Q2JLD7|TRPB_SYNJB Tryptophan synthase beta chain OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=trpB PE=3 SV=1 1 373 1.0E-151
sp|Q7W5G8|TRPB_BORPA Tryptophan synthase beta chain OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=trpB PE=3 SV=1 1 367 2.0E-151
sp|Q7WD04|TRPB_BORBR Tryptophan synthase beta chain OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=trpB PE=3 SV=1 1 367 2.0E-151
sp|Q5WGS1|TRPB_BACSK Tryptophan synthase beta chain OS=Bacillus clausii (strain KSM-K16) GN=trpB PE=3 SV=1 1 365 2.0E-151
sp|Q9YGB0|TRPB1_THEKO Tryptophan synthase beta chain 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=trpB1 PE=3 SV=1 1 365 2.0E-151
sp|Q5SJB9|TRPB_THET8 Tryptophan synthase beta chain OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=trpB PE=3 SV=1 1 365 2.0E-151
sp|O50046|TRPB_CAMAC Tryptophan synthase beta chain 2, chloroplastic OS=Camptotheca acuminata GN=TSB PE=2 SV=1 1 369 2.0E-151
sp|B9JXV6|TRPB_AGRVS Tryptophan synthase beta chain OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=trpB PE=3 SV=1 1 365 3.0E-151
sp|Q2P0U2|TRPB_XANOM Tryptophan synthase beta chain OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=trpB PE=3 SV=1 4 366 3.0E-151
sp|A9IIE0|TRPB_BORPD Tryptophan synthase beta chain OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=trpB PE=3 SV=1 4 367 4.0E-151
sp|Q3BRL3|TRPB_XANC5 Tryptophan synthase beta chain OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=trpB PE=3 SV=1 4 366 7.0E-151
sp|B2SVN7|TRPB_XANOP Tryptophan synthase beta chain OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=trpB PE=3 SV=1 4 366 8.0E-151
sp|Q8PJ28|TRPB_XANAC Tryptophan synthase beta chain OS=Xanthomonas axonopodis pv. citri (strain 306) GN=trpB PE=3 SV=1 4 366 8.0E-151
sp|Q9CC54|TRPB_MYCLE Tryptophan synthase beta chain OS=Mycobacterium leprae (strain TN) GN=trpB PE=3 SV=1 29 366 1.0E-150
sp|P43283|TRPB1_MAIZE Tryptophan synthase beta chain 1 (Fragment) OS=Zea mays GN=TSB1 PE=2 SV=1 1 369 1.0E-150
sp|Q8P7R8|TRPB_XANCP Tryptophan synthase beta chain OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=trpB PE=3 SV=1 4 366 2.0E-150
sp|B0RR84|TRPB_XANCB Tryptophan synthase beta chain OS=Xanthomonas campestris pv. campestris (strain B100) GN=trpB PE=3 SV=1 4 366 2.0E-150
sp|Q4UWD2|TRPB_XANC8 Tryptophan synthase beta chain OS=Xanthomonas campestris pv. campestris (strain 8004) GN=trpB PE=3 SV=1 4 366 2.0E-150
sp|Q8NWU2|TRPB_STAAW Tryptophan synthase beta chain OS=Staphylococcus aureus (strain MW2) GN=trpB PE=3 SV=1 1 365 2.0E-150
sp|A8Z244|TRPB_STAAT Tryptophan synthase beta chain OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=trpB PE=3 SV=1 1 365 2.0E-150
sp|A6QGS4|TRPB_STAAE Tryptophan synthase beta chain OS=Staphylococcus aureus (strain Newman) GN=trpB PE=3 SV=1 1 365 2.0E-150
sp|Q5HG47|TRPB_STAAC Tryptophan synthase beta chain OS=Staphylococcus aureus (strain COL) GN=trpB PE=3 SV=1 1 365 2.0E-150
sp|Q2FYR4|TRPB_STAA8 Tryptophan synthase beta chain OS=Staphylococcus aureus (strain NCTC 8325) GN=trpB PE=3 SV=1 1 365 2.0E-150
sp|Q2FH64|TRPB_STAA3 Tryptophan synthase beta chain OS=Staphylococcus aureus (strain USA300) GN=trpB PE=3 SV=1 1 365 2.0E-150
sp|P66987|TRPB_STAAN Tryptophan synthase beta chain OS=Staphylococcus aureus (strain N315) GN=trpB PE=3 SV=1 1 365 2.0E-150
sp|P66986|TRPB_STAAM Tryptophan synthase beta chain OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trpB PE=3 SV=1 1 365 2.0E-150
sp|A5ISQ4|TRPB_STAA9 Tryptophan synthase beta chain OS=Staphylococcus aureus (strain JH9) GN=trpB PE=3 SV=1 1 365 2.0E-150
sp|A6U1J4|TRPB_STAA2 Tryptophan synthase beta chain OS=Staphylococcus aureus (strain JH1) GN=trpB PE=3 SV=1 1 365 2.0E-150
sp|A7X238|TRPB_STAA1 Tryptophan synthase beta chain OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=trpB PE=3 SV=1 1 365 2.0E-150
sp|P9WFX9|TRPB_MYCTU Tryptophan synthase beta chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trpB PE=1 SV=1 1 366 2.0E-150
sp|P9WFX8|TRPB_MYCTO Tryptophan synthase beta chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trpB PE=3 SV=1 1 366 2.0E-150
sp|P66985|TRPB_MYCBO Tryptophan synthase beta chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=trpB PE=3 SV=1 1 366 2.0E-150
sp|Q6GH33|TRPB_STAAR Tryptophan synthase beta chain OS=Staphylococcus aureus (strain MRSA252) GN=trpB PE=3 SV=1 1 365 4.0E-150
sp|Q7VTF1|TRPB_BORPE Tryptophan synthase beta chain OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=trpB PE=3 SV=1 1 367 4.0E-150
sp|P43284|TRPB2_MAIZE Tryptophan synthase beta chain 2, chloroplastic (Fragment) OS=Zea mays GN=TSB2 PE=2 SV=1 1 369 5.0E-150
sp|A5CVH4|TRPB_VESOH Tryptophan synthase beta chain OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=trpB PE=3 SV=1 1 366 5.0E-150
sp|B0U6K6|TRPB_XYLFM Tryptophan synthase beta chain OS=Xylella fastidiosa (strain M12) GN=trpB PE=3 SV=1 4 366 5.0E-150
sp|Q9PDK4|TRPB_XYLFA Tryptophan synthase beta chain OS=Xylella fastidiosa (strain 9a5c) GN=trpB PE=3 SV=2 4 366 7.0E-150
sp|Q6G9I7|TRPB_STAAS Tryptophan synthase beta chain OS=Staphylococcus aureus (strain MSSA476) GN=trpB PE=3 SV=1 1 365 9.0E-150
sp|B2IF48|TRPB_BEII9 Tryptophan synthase beta chain OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=trpB PE=3 SV=1 1 373 1.0E-149
sp|Q2YXX2|TRPB_STAAB Tryptophan synthase beta chain OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=trpB PE=3 SV=1 1 365 2.0E-149
sp|Q87DR9|TRPB_XYLFT Tryptophan synthase beta chain OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=trpB PE=3 SV=1 4 366 2.0E-149
sp|B2I9J2|TRPB_XYLF2 Tryptophan synthase beta chain OS=Xylella fastidiosa (strain M23) GN=trpB PE=3 SV=1 4 366 2.0E-149
sp|A8LSF9|TRPB_DINSH Tryptophan synthase beta chain OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=trpB PE=3 SV=1 1 369 3.0E-149
sp|A7Z616|TRPB_BACMF Tryptophan synthase beta chain OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=trpB PE=3 SV=1 1 376 4.0E-149
sp|Q2Y7R4|TRPB_NITMU Tryptophan synthase beta chain OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=trpB PE=3 SV=1 4 366 4.0E-149
sp|A5FY57|TRPB_ACICJ Tryptophan synthase beta chain OS=Acidiphilium cryptum (strain JF-5) GN=trpB PE=3 SV=1 1 369 7.0E-149
sp|P50909|TRPB1_THEMA Tryptophan synthase beta chain 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpB1 PE=3 SV=1 14 367 7.0E-149
sp|Q28LA6|TRPB_JANSC Tryptophan synthase beta chain OS=Jannaschia sp. (strain CCS1) GN=trpB PE=3 SV=1 1 380 2.0E-148
sp|Q49XH8|TRPB_STAS1 Tryptophan synthase beta chain OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=trpB PE=3 SV=1 1 373 2.0E-148
sp|Q053M6|TRPB_LEPBL Tryptophan synthase beta chain OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=trpB PE=3 SV=1 2 366 2.0E-148
sp|Q04U63|TRPB_LEPBJ Tryptophan synthase beta chain OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=trpB PE=3 SV=1 2 366 2.0E-148
sp|Q07UH1|TRPB_RHOP5 Tryptophan synthase beta chain OS=Rhodopseudomonas palustris (strain BisA53) GN=trpB PE=3 SV=1 1 369 3.0E-148
sp|Q161H9|TRPB_ROSDO Tryptophan synthase beta chain OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=trpB PE=3 SV=1 1 369 3.0E-148
sp|Q9RVT1|TRPB_DEIRA Tryptophan synthase beta chain OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=trpB PE=3 SV=1 1 365 5.0E-148
sp|Q8F149|TRPB_LEPIN Tryptophan synthase beta chain OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=trpB PE=3 SV=1 2 366 2.0E-147
sp|Q72U05|TRPB_LEPIC Tryptophan synthase beta chain OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=trpB PE=3 SV=1 2 366 2.0E-147
sp|Q6AF67|TRPB_LEIXX Tryptophan synthase beta chain OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=trpB PE=3 SV=1 3 364 3.0E-147
sp|B4S1J4|TRPB_ALTMD Tryptophan synthase beta chain OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=trpB PE=3 SV=1 3 369 4.0E-147
sp|P56142|TRPB_HELPY Tryptophan synthase beta chain OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trpB PE=3 SV=1 4 369 6.0E-146
sp|Q1ISI9|TRPB_KORVE Tryptophan synthase beta chain OS=Koribacter versatilis (strain Ellin345) GN=trpB PE=3 SV=1 1 369 2.0E-145
sp|Q8RGH8|TRPB_FUSNN Tryptophan synthase beta chain OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=trpB PE=3 SV=1 3 369 1.0E-144
sp|Q9ZJU9|TRPB_HELPJ Tryptophan synthase beta chain OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trpB PE=3 SV=1 4 369 1.0E-144
sp|A1S7I2|TRPB_SHEAM Tryptophan synthase beta chain OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=trpB PE=3 SV=1 1 369 3.0E-144
sp|A3QF73|TRPB_SHELP Tryptophan synthase beta chain OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=trpB PE=3 SV=1 1 371 5.0E-144
sp|B0SM57|TRPB_LEPBP Tryptophan synthase beta chain OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=trpB PE=3 SV=1 2 365 3.0E-143
sp|B0SDM8|TRPB_LEPBA Tryptophan synthase beta chain OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=trpB PE=3 SV=1 2 365 3.0E-143
sp|O68905|TRPB_MYCIT Tryptophan synthase beta chain OS=Mycobacterium intracellulare GN=trpB PE=3 SV=1 29 366 4.0E-143
sp|P14638|TRPB_METVO Tryptophan synthase beta chain OS=Methanococcus voltae GN=trpB PE=3 SV=1 3 373 6.0E-143
sp|Q8CPB1|TRPB_STAES Tryptophan synthase beta chain OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trpB PE=3 SV=1 1 365 1.0E-142
sp|Q5HPH0|TRPB_STAEQ Tryptophan synthase beta chain OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trpB PE=3 SV=1 1 365 1.0E-142
sp|Q12LE2|TRPB_SHEDO Tryptophan synthase beta chain OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=trpB PE=3 SV=1 4 369 2.0E-142
sp|Q7M8W7|TRPB2_WOLSU Tryptophan synthase beta chain 2 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=trpB2 PE=3 SV=1 1 362 2.0E-142
sp|Q88WI0|TRPB_LACPL Tryptophan synthase beta chain OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=trpB PE=3 SV=1 1 366 1.0E-141
sp|Q8KF11|TRPB_CHLTE Tryptophan synthase beta chain OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trpB-1 PE=3 SV=1 5 369 2.0E-141
sp|B1KK02|TRPB_SHEWM Tryptophan synthase beta chain OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=trpB PE=3 SV=1 1 369 3.0E-141
sp|B8CLM6|TRPB_SHEPW Tryptophan synthase beta chain OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=trpB PE=3 SV=1 1 371 3.0E-141
sp|A8H2X4|TRPB_SHEPA Tryptophan synthase beta chain OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=trpB PE=3 SV=1 1 369 3.0E-141
sp|A9KTR7|TRPB_SHEB9 Tryptophan synthase beta chain OS=Shewanella baltica (strain OS195) GN=trpB PE=3 SV=1 4 369 8.0E-141
sp|A4Y845|TRPB_SHEPC Tryptophan synthase beta chain OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=trpB PE=3 SV=1 4 369 8.0E-141
sp|A6WPX1|TRPB_SHEB8 Tryptophan synthase beta chain OS=Shewanella baltica (strain OS185) GN=trpB PE=3 SV=1 4 369 1.0E-140
sp|A1RIE3|TRPB_SHESW Tryptophan synthase beta chain OS=Shewanella sp. (strain W3-18-1) GN=trpB PE=3 SV=1 4 369 1.0E-140
sp|Q0HK81|TRPB_SHESM Tryptophan synthase beta chain OS=Shewanella sp. (strain MR-4) GN=trpB PE=3 SV=1 4 369 1.0E-140
sp|A0KVD1|TRPB_SHESA Tryptophan synthase beta chain OS=Shewanella sp. (strain ANA-3) GN=trpB PE=3 SV=1 4 369 1.0E-140
sp|B0TP63|TRPB_SHEHH Tryptophan synthase beta chain OS=Shewanella halifaxensis (strain HAW-EB4) GN=trpB PE=3 SV=1 1 369 2.0E-140
sp|Q0HWI3|TRPB_SHESR Tryptophan synthase beta chain OS=Shewanella sp. (strain MR-7) GN=trpB PE=3 SV=1 4 369 4.0E-140
sp|A3D630|TRPB_SHEB5 Tryptophan synthase beta chain OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=trpB PE=3 SV=1 4 369 5.0E-140
sp|A2STA4|TRPB_METLZ Tryptophan synthase beta chain OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=trpB PE=3 SV=1 1 366 7.0E-140
sp|Q8ECV0|TRPB_SHEON Tryptophan synthase beta chain OS=Shewanella oneidensis (strain MR-1) GN=trpB PE=3 SV=1 4 369 2.0E-139
sp|P06561|TRPB_CORGL Tryptophan synthase beta chain OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=trpB PE=3 SV=2 1 365 2.0E-139
sp|A4QI76|TRPB_CORGB Tryptophan synthase beta chain OS=Corynebacterium glutamicum (strain R) GN=trpB PE=3 SV=1 1 365 2.0E-139
sp|Q084N8|TRPB_SHEFN Tryptophan synthase beta chain OS=Shewanella frigidimarina (strain NCIMB 400) GN=trpB PE=3 SV=1 4 369 2.0E-139
sp|Q5E623|TRPB_VIBF1 Tryptophan synthase beta chain OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=trpB PE=3 SV=1 4 373 2.0E-138
sp|Q15RZ5|TRPB_PSEA6 Tryptophan synthase beta chain OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=trpB PE=3 SV=1 3 365 4.0E-138
sp|Q8TLP3|TRPB1_METAC Tryptophan synthase beta chain 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=trpB1 PE=3 SV=1 1 365 4.0E-138
sp|B5FDB7|TRPB_VIBFM Tryptophan synthase beta chain OS=Vibrio fischeri (strain MJ11) GN=trpB PE=3 SV=1 4 373 5.0E-138
sp|Q6LPA4|TRPB_PHOPR Tryptophan synthase beta chain OS=Photobacterium profundum GN=trpB PE=3 SV=1 4 369 8.0E-138
sp|Q8PT95|TRPB1_METMA Tryptophan synthase beta chain 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=trpB1 PE=3 SV=2 1 365 9.0E-138
sp|Q8TX91|TRPB_METKA Tryptophan synthase beta chain OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=trpB PE=3 SV=1 1 369 1.0E-137
sp|A4SKT1|TRPB_AERS4 Tryptophan synthase beta chain OS=Aeromonas salmonicida (strain A449) GN=trpB PE=3 SV=1 1 373 2.0E-137
sp|A0KMD0|TRPB_AERHH Tryptophan synthase beta chain OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=trpB PE=3 SV=1 1 373 2.0E-137
sp|Q03CY3|TRPB_LACC3 Tryptophan synthase beta chain OS=Lactobacillus casei (strain ATCC 334) GN=trpB PE=3 SV=1 1 366 3.0E-136
sp|B3W6W6|TRPB_LACCB Tryptophan synthase beta chain OS=Lactobacillus casei (strain BL23) GN=trpB PE=3 SV=1 1 366 3.0E-136
sp|P17167|TRPB_LACCA Tryptophan synthase beta chain OS=Lactobacillus casei GN=trpB PE=3 SV=1 1 366 2.0E-135
sp|A5UEU5|TRPB_HAEIG Tryptophan synthase beta chain OS=Haemophilus influenzae (strain PittGG) GN=trpB PE=3 SV=1 4 365 3.0E-135
sp|C6DGZ5|TRPB_PECCP Tryptophan synthase beta chain OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=trpB PE=3 SV=1 1 369 5.0E-135
sp|Q65TF0|TRPB_MANSM Tryptophan synthase beta chain OS=Mannheimia succiniciproducens (strain MBEL55E) GN=trpB PE=3 SV=1 1 365 8.0E-135
sp|C5BDB7|TRPB_EDWI9 Tryptophan synthase beta chain OS=Edwardsiella ictaluri (strain 93-146) GN=trpB PE=3 SV=1 1 373 9.0E-135
sp|A8GF82|TRPB_SERP5 Tryptophan synthase beta chain OS=Serratia proteamaculans (strain 568) GN=trpB PE=3 SV=1 1 369 1.0E-134
sp|A5UC40|TRPB_HAEIE Tryptophan synthase beta chain OS=Haemophilus influenzae (strain PittEE) GN=trpB PE=3 SV=1 4 365 3.0E-134
sp|P43760|TRPB_HAEIN Tryptophan synthase beta chain OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trpB PE=3 SV=1 4 365 3.0E-134
sp|A4WB02|TRPB_ENT38 Tryptophan synthase beta chain OS=Enterobacter sp. (strain 638) GN=trpB PE=3 SV=1 1 369 4.0E-134
sp|Q8FLJ6|TRPB1_COREF Tryptophan synthase beta chain 1 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=trpB1 PE=3 SV=1 1 365 6.0E-134
sp|C3LLL6|TRPB_VIBCM Tryptophan synthase beta chain OS=Vibrio cholerae serotype O1 (strain M66-2) GN=trpB PE=3 SV=1 3 365 1.0E-133
sp|Q9KST6|TRPB_VIBCH Tryptophan synthase beta chain OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trpB PE=3 SV=1 3 365 1.0E-133
sp|A5F208|TRPB_VIBC3 Tryptophan synthase beta chain OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=trpB PE=3 SV=1 3 365 1.0E-133
sp|Q822W3|TRPB2_CHLCV Tryptophan synthase beta chain 2 OS=Chlamydophila caviae (strain GPIC) GN=trpB2 PE=3 SV=1 1 367 2.0E-133
sp|B6EJA3|TRPB_ALISL Tryptophan synthase beta chain OS=Aliivibrio salmonicida (strain LFI1238) GN=trpB PE=3 SV=1 4 373 2.0E-133
sp|Q5NE79|TRPB_FRATT Tryptophan synthase beta chain OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=trpB PE=3 SV=1 4 373 2.0E-133
sp|B2SEK7|TRPB_FRATM Tryptophan synthase beta chain OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=trpB PE=3 SV=1 4 373 2.0E-133
sp|Q14FN2|TRPB_FRAT1 Tryptophan synthase beta chain OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=trpB PE=3 SV=1 4 373 2.0E-133
sp|A4IVS4|TRPB_FRATW Tryptophan synthase beta chain OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=trpB PE=3 SV=1 4 373 2.0E-133
sp|B2VKT2|TRPB_ERWT9 Tryptophan synthase beta chain OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=trpB PE=3 SV=1 1 369 2.0E-133
sp|B7VGU7|TRPB_VIBTL Tryptophan synthase beta chain OS=Vibrio tasmaniensis (strain LGP32) GN=trpB PE=3 SV=1 3 373 3.0E-133
sp|Q7MM56|TRPB_VIBVY Tryptophan synthase beta chain OS=Vibrio vulnificus (strain YJ016) GN=trpB PE=3 SV=1 3 365 3.0E-133
sp|Q8D8B2|TRPB_VIBVU Tryptophan synthase beta chain OS=Vibrio vulnificus (strain CMCP6) GN=trpB PE=3 SV=1 3 365 3.0E-133
sp|A7MRY0|TRPB_VIBCB Tryptophan synthase beta chain OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=trpB PE=3 SV=1 3 365 4.0E-133
sp|A1STT0|TRPB_PSYIN Tryptophan synthase beta chain OS=Psychromonas ingrahamii (strain 37) GN=trpB PE=3 SV=1 4 367 4.0E-133
sp|B0TWI3|TRPB_FRAP2 Tryptophan synthase beta chain OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=trpB PE=3 SV=1 4 373 5.0E-133
sp|B3GX46|TRPB_ACTP7 Tryptophan synthase beta chain OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=trpB PE=3 SV=1 4 365 5.0E-133
sp|P22097|TRPB1_VIBPA Tryptophan synthase beta chain 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=trpB1 PE=3 SV=2 3 365 6.0E-133
sp|A3MZI7|TRPB_ACTP2 Tryptophan synthase beta chain OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=trpB PE=3 SV=1 4 365 7.0E-133
sp|Q6D4U0|TRPB_PECAS Tryptophan synthase beta chain OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=trpB PE=3 SV=1 1 369 8.0E-133
sp|Q0BP45|TRPB_FRATO Tryptophan synthase beta chain OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=trpB PE=3 SV=1 4 373 1.0E-132
sp|Q2A5V3|TRPB_FRATH Tryptophan synthase beta chain OS=Francisella tularensis subsp. holarctica (strain LVS) GN=trpB PE=3 SV=1 4 373 1.0E-132
sp|A7N9D2|TRPB_FRATF Tryptophan synthase beta chain OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=trpB PE=3 SV=1 4 373 1.0E-132
sp|Q2NT52|TRPB_SODGM Tryptophan synthase beta chain OS=Sodalis glossinidius (strain morsitans) GN=trpB PE=3 SV=1 1 369 1.0E-132
sp|C4LC89|TRPB_TOLAT Tryptophan synthase beta chain OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=trpB PE=3 SV=1 1 369 1.0E-132
sp|A0Q8M6|TRPB_FRATN Tryptophan synthase beta chain OS=Francisella tularensis subsp. novicida (strain U112) GN=trpB PE=3 SV=1 4 373 3.0E-132
sp|A1JPX6|TRPB_YERE8 Tryptophan synthase beta chain OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=trpB PE=3 SV=1 1 369 6.0E-132
sp|B4EWH7|TRPB_PROMH Tryptophan synthase beta chain OS=Proteus mirabilis (strain HI4320) GN=trpB PE=3 SV=1 1 369 8.0E-132
sp|B0BU72|TRPB_ACTPJ Tryptophan synthase beta chain OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=trpB PE=3 SV=1 4 365 8.0E-132
sp|Q64SX9|TRPB_BACFR Tryptophan synthase beta chain OS=Bacteroides fragilis (strain YCH46) GN=trpB PE=3 SV=1 3 364 1.0E-131
sp|Q5LBZ8|TRPB_BACFN Tryptophan synthase beta chain OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=trpB PE=3 SV=1 3 364 1.0E-131
sp|Q8AAD2|TRPB_BACTN Tryptophan synthase beta chain OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=trpB PE=3 SV=1 3 364 4.0E-131
sp|O68428|TRPB_BUCDN Tryptophan synthase beta chain OS=Buchnera aphidicola subsp. Diuraphis noxia GN=trpB PE=3 SV=1 1 376 4.0E-131
sp|A9MPY7|TRPB_SALAR Tryptophan synthase beta chain OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=trpB PE=3 SV=1 1 369 4.0E-131
sp|Q1RCA6|TRPB_ECOUT Tryptophan synthase beta chain OS=Escherichia coli (strain UTI89 / UPEC) GN=trpB PE=3 SV=1 1 369 4.0E-131
sp|A1AAN1|TRPB_ECOK1 Tryptophan synthase beta chain OS=Escherichia coli O1:K1 / APEC GN=trpB PE=3 SV=1 1 369 4.0E-131
sp|B7ML77|TRPB_ECO45 Tryptophan synthase beta chain OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=trpB PE=3 SV=1 1 369 4.0E-131
sp|A6L7M5|TRPB_BACV8 Tryptophan synthase beta chain OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=trpB PE=3 SV=1 3 368 5.0E-131
sp|Q57NT3|TRPB_SALCH Tryptophan synthase beta chain OS=Salmonella choleraesuis (strain SC-B67) GN=trpB PE=3 SV=1 1 369 5.0E-131
sp|A6VPD9|TRPB_ACTSZ Tryptophan synthase beta chain OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=trpB PE=3 SV=1 4 365 5.0E-131
sp|B1JKS2|TRPB_YERPY Tryptophan synthase beta chain OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=trpB PE=3 SV=1 4 369 6.0E-131
sp|Q66AK4|TRPB_YERPS Tryptophan synthase beta chain OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=trpB PE=3 SV=1 4 369 6.0E-131
sp|A4TJ67|TRPB_YERPP Tryptophan synthase beta chain OS=Yersinia pestis (strain Pestoides F) GN=trpB PE=3 SV=1 4 369 6.0E-131
sp|Q1CJ28|TRPB_YERPN Tryptophan synthase beta chain OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=trpB PE=3 SV=1 4 369 6.0E-131
sp|Q8ZEG9|TRPB_YERPE Tryptophan synthase beta chain OS=Yersinia pestis GN=trpB PE=3 SV=1 4 369 6.0E-131
sp|B2K3W2|TRPB_YERPB Tryptophan synthase beta chain OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=trpB PE=3 SV=1 4 369 6.0E-131
sp|Q1C7P2|TRPB_YERPA Tryptophan synthase beta chain OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=trpB PE=3 SV=1 4 369 6.0E-131
sp|A7FI33|TRPB_YERP3 Tryptophan synthase beta chain OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=trpB PE=3 SV=1 4 369 6.0E-131
sp|Q4QKF5|TRPB_HAEI8 Tryptophan synthase beta chain OS=Haemophilus influenzae (strain 86-028NP) GN=trpB PE=3 SV=1 4 365 6.0E-131
sp|B5XT02|TRPB_KLEP3 Tryptophan synthase beta chain OS=Klebsiella pneumoniae (strain 342) GN=trpB PE=3 SV=1 1 369 7.0E-131
sp|A6T7W6|TRPB_KLEP7 Tryptophan synthase beta chain OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=trpB PE=3 SV=1 1 369 9.0E-131
sp|Q3Z109|TRPB_SHISS Tryptophan synthase beta chain OS=Shigella sonnei (strain Ss046) GN=trpB PE=3 SV=1 1 369 1.0E-130
sp|B5YZP1|TRPB_ECO5E Tryptophan synthase beta chain OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=trpB PE=3 SV=1 1 369 1.0E-130
sp|Q8X7B6|TRPB_ECO57 Tryptophan synthase beta chain OS=Escherichia coli O157:H7 GN=trpB PE=3 SV=3 1 369 1.0E-130
sp|Q7N486|TRPB_PHOLL Tryptophan synthase beta chain OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=trpB PE=3 SV=1 1 373 1.0E-130
sp|P0A2K1|TRPB_SALTY Tryptophan synthase beta chain OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trpB PE=1 SV=2 1 369 1.0E-130
sp|P0A2K2|TRPB_SALTI Tryptophan synthase beta chain OS=Salmonella typhi GN=trpB PE=3 SV=2 1 369 1.0E-130
sp|B4TX38|TRPB_SALSV Tryptophan synthase beta chain OS=Salmonella schwarzengrund (strain CVM19633) GN=trpB PE=3 SV=1 1 369 1.0E-130
sp|B5BIC1|TRPB_SALPK Tryptophan synthase beta chain OS=Salmonella paratyphi A (strain AKU_12601) GN=trpB PE=3 SV=1 1 369 1.0E-130
sp|C0Q3N4|TRPB_SALPC Tryptophan synthase beta chain OS=Salmonella paratyphi C (strain RKS4594) GN=trpB PE=3 SV=1 1 369 1.0E-130
sp|A9MWR4|TRPB_SALPB Tryptophan synthase beta chain OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=trpB PE=3 SV=1 1 369 1.0E-130
sp|Q5PD17|TRPB_SALPA Tryptophan synthase beta chain OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=trpB PE=3 SV=1 1 369 1.0E-130
sp|B4T6X1|TRPB_SALNS Tryptophan synthase beta chain OS=Salmonella newport (strain SL254) GN=trpB PE=3 SV=1 1 369 1.0E-130
sp|B4TJK8|TRPB_SALHS Tryptophan synthase beta chain OS=Salmonella heidelberg (strain SL476) GN=trpB PE=3 SV=1 1 369 1.0E-130
sp|B5R6M5|TRPB_SALG2 Tryptophan synthase beta chain OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=trpB PE=3 SV=1 1 369 1.0E-130
sp|B5R3P4|TRPB_SALEP Tryptophan synthase beta chain OS=Salmonella enteritidis PT4 (strain P125109) GN=trpB PE=3 SV=1 1 369 1.0E-130
sp|B5FU66|TRPB_SALDC Tryptophan synthase beta chain OS=Salmonella dublin (strain CT_02021853) GN=trpB PE=3 SV=1 1 369 1.0E-130
sp|B5F4M4|TRPB_SALA4 Tryptophan synthase beta chain OS=Salmonella agona (strain SL483) GN=trpB PE=3 SV=1 1 369 1.0E-130
sp|B0UU34|TRPB_HISS2 Tryptophan synthase beta chain OS=Histophilus somni (strain 2336) GN=trpB PE=3 SV=1 4 365 2.0E-130
sp|Q32GS9|TRPB_SHIDS Tryptophan synthase beta chain OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=trpB PE=3 SV=1 1 369 2.0E-130
sp|B1LH31|TRPB_ECOSM Tryptophan synthase beta chain OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=trpB PE=3 SV=1 1 369 2.0E-130
sp|Q8FHV9|TRPB_ECOL6 Tryptophan synthase beta chain OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trpB PE=3 SV=3 1 369 2.0E-130
sp|Q0TIA9|TRPB_ECOL5 Tryptophan synthase beta chain OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=trpB PE=3 SV=1 1 369 2.0E-130
sp|B7MUA0|TRPB_ECO81 Tryptophan synthase beta chain OS=Escherichia coli O81 (strain ED1a) GN=trpB PE=3 SV=1 1 369 2.0E-130
sp|B7NVN1|TRPB_ECO7I Tryptophan synthase beta chain OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=trpB PE=3 SV=1 1 369 2.0E-130
sp|B7UR67|TRPB_ECO27 Tryptophan synthase beta chain OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=trpB PE=3 SV=1 1 369 2.0E-130
sp|P0A880|TRPB_SHIFL Tryptophan synthase beta chain OS=Shigella flexneri GN=trpB PE=3 SV=2 1 369 2.0E-130
sp|Q0T5D5|TRPB_SHIF8 Tryptophan synthase beta chain OS=Shigella flexneri serotype 5b (strain 8401) GN=trpB PE=3 SV=1 1 369 2.0E-130
sp|B6I9X5|TRPB_ECOSE Tryptophan synthase beta chain OS=Escherichia coli (strain SE11) GN=trpB PE=3 SV=1 1 369 2.0E-130
sp|P0A879|TRPB_ECOLI Tryptophan synthase beta chain OS=Escherichia coli (strain K12) GN=trpB PE=1 SV=2 1 369 2.0E-130
sp|B1ITJ4|TRPB_ECOLC Tryptophan synthase beta chain OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=trpB PE=3 SV=1 1 369 2.0E-130
sp|A7ZZJ7|TRPB_ECOHS Tryptophan synthase beta chain OS=Escherichia coli O9:H4 (strain HS) GN=trpB PE=3 SV=1 1 369 2.0E-130
sp|B1XBL0|TRPB_ECODH Tryptophan synthase beta chain OS=Escherichia coli (strain K12 / DH10B) GN=trpB PE=3 SV=1 1 369 2.0E-130
sp|B7LY17|TRPB_ECO8A Tryptophan synthase beta chain OS=Escherichia coli O8 (strain IAI1) GN=trpB PE=3 SV=1 1 369 2.0E-130
sp|B7L493|TRPB_ECO55 Tryptophan synthase beta chain OS=Escherichia coli (strain 55989 / EAEC) GN=trpB PE=3 SV=1 1 369 2.0E-130
sp|A7ZL79|TRPB_ECO24 Tryptophan synthase beta chain OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=trpB PE=3 SV=1 1 369 2.0E-130
sp|A8AG61|TRPB_CITK8 Tryptophan synthase beta chain OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=trpB PE=3 SV=1 1 369 2.0E-130
sp|Q31ZV4|TRPB_SHIBS Tryptophan synthase beta chain OS=Shigella boydii serotype 4 (strain Sb227) GN=trpB PE=3 SV=1 1 369 5.0E-130
sp|B2U0F2|TRPB_SHIB3 Tryptophan synthase beta chain OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=trpB PE=3 SV=1 1 369 5.0E-130
sp|B7LS19|TRPB_ESCF3 Tryptophan synthase beta chain OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=trpB PE=3 SV=1 1 369 7.0E-130
sp|P54203|TRPB_PASMU Tryptophan synthase beta chain OS=Pasteurella multocida (strain Pm70) GN=trpB PE=3 SV=2 1 365 7.0E-130
sp|A7MMG1|TRPB_CROS8 Tryptophan synthase beta chain OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=trpB PE=3 SV=1 1 367 8.0E-130
sp|B7N474|TRPB_ECOLU Tryptophan synthase beta chain OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=trpB PE=3 SV=1 1 369 2.0E-129
sp|O27696|TRPB1_METTH Tryptophan synthase beta chain 1 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trpB1 PE=3 SV=1 3 366 3.0E-129
sp|P42391|TRPB_BUCAP Tryptophan synthase beta chain OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trpB PE=3 SV=1 1 371 4.0E-129
sp|A6L9K4|TRPB_PARD8 Tryptophan synthase beta chain OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=trpB PE=3 SV=1 3 364 2.0E-128
sp|Q492N6|TRPB_BLOPB Tryptophan synthase beta chain OS=Blochmannia pennsylvanicus (strain BPEN) GN=trpB PE=3 SV=1 1 371 3.0E-128
sp|Q8FT12|TRPB2_COREF Tryptophan synthase beta chain 2 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=trpB2 PE=3 SV=2 1 365 1.0E-126
sp|P59458|TRPB_BUCBP Tryptophan synthase beta chain OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trpB PE=3 SV=1 1 365 2.0E-126
sp|P26921|TRPB2_METTM Tryptophan synthase beta chain 2 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=trpB2 PE=3 SV=1 3 362 4.0E-126
sp|B6YQ32|TRPB_AZOPC Tryptophan synthase beta chain OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=trpB PE=3 SV=1 4 364 9.0E-125
sp|Q59169|TRPB_BUCSC Tryptophan synthase beta chain OS=Buchnera aphidicola subsp. Schlechtendalia chinensis GN=trpB PE=3 SV=1 1 371 1.0E-124
sp|O84172|TRPB_CHLTR Tryptophan synthase beta chain OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=trpB PE=3 SV=1 29 365 8.0E-124
sp|Q5HWB9|TRPB_CAMJR Tryptophan synthase beta chain OS=Campylobacter jejuni (strain RM1221) GN=trpB PE=3 SV=1 1 367 1.0E-123
sp|A1VY69|TRPB_CAMJJ Tryptophan synthase beta chain OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=trpB PE=3 SV=1 1 367 1.0E-123
sp|Q9PIF2|TRPB_CAMJE Tryptophan synthase beta chain OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=trpB PE=3 SV=1 1 367 1.0E-123
sp|A8FKD7|TRPB_CAMJ8 Tryptophan synthase beta chain OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=trpB PE=3 SV=1 1 367 1.0E-123
sp|P18285|TRPB_HALVD Tryptophan synthase beta chain OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=trpB PE=3 SV=2 1 368 2.0E-123
sp|Q44685|TRPB_BUCAI Tryptophan synthase beta chain OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trpB PE=3 SV=2 1 352 2.0E-123
sp|Q44687|TRPB_BUCMH Tryptophan synthase beta chain OS=Buchnera aphidicola subsp. Melaphis rhois GN=trpB PE=3 SV=2 1 369 5.0E-123
sp|Q7VR00|TRPB_BLOFL Tryptophan synthase beta chain OS=Blochmannia floridanus GN=trpB PE=3 SV=1 1 369 6.0E-123
sp|B2KCI5|TRPB_ELUMP Tryptophan synthase beta chain OS=Elusimicrobium minutum (strain Pei191) GN=trpB PE=3 SV=1 4 365 2.0E-121
sp|Q7M9S1|TRPB1_WOLSU Tryptophan synthase beta chain 1 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=trpB1 PE=3 SV=1 1 367 2.0E-119
sp|A7H523|TRPB_CAMJD Tryptophan synthase beta chain OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=trpB PE=3 SV=1 30 365 6.0E-119
sp|Q9RCE8|TRPB_VIBME Tryptophan synthase beta chain OS=Vibrio metschnikovii GN=trpB PE=3 SV=1 3 365 7.0E-117
sp|Q7VGA7|TRPB_HELHP Tryptophan synthase beta chain OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=trpB PE=3 SV=1 1 369 1.0E-115
sp|B2V2T4|TRPB_CLOBA Tryptophan synthase beta chain OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=trpB PE=3 SV=1 4 367 5.0E-115
sp|B2TM49|TRPB_CLOBB Tryptophan synthase beta chain OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=trpB PE=3 SV=1 4 367 4.0E-114
sp|Q822W9|TRPB1_CHLCV Tryptophan synthase beta chain 1 OS=Chlamydophila caviae (strain GPIC) GN=trpB1 PE=3 SV=1 4 367 1.0E-113
sp|Q87IM1|TRPB2_VIBPA Tryptophan synthase beta chain 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=trpB2 PE=3 SV=1 4 367 4.0E-113
sp|Q9HSC0|TRPB_HALSA Tryptophan synthase beta chain OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=trpB PE=3 SV=1 1 365 1.0E-110
sp|B0R332|TRPB_HALS3 Tryptophan synthase beta chain OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=trpB PE=3 SV=1 1 365 1.0E-110
sp|Q44688|TRPB_BUCRP Tryptophan synthase beta chain (Fragment) OS=Buchnera aphidicola subsp. Rhopalosiphum padi GN=trpB PE=3 SV=1 96 320 3.0E-84
sp|Q44686|TRPB_BUCRM Tryptophan synthase beta chain (Fragment) OS=Buchnera aphidicola subsp. Rhopalosiphum maidis GN=trpB PE=3 SV=1 96 320 1.0E-81
sp|A4WKQ9|TRPB_PYRAR Tryptophan synthase beta chain OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=trpB PE=3 SV=1 22 361 3.0E-40
sp|Q8U0J5|TRPB2_PYRFU Tryptophan synthase beta chain 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=trpB2 PE=3 SV=1 22 369 1.0E-39
sp|Q8ZV44|TRPB_PYRAE Tryptophan synthase beta chain OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=trpB PE=3 SV=1 22 361 8.0E-39
sp|O59265|TRPB_PYRHO Tryptophan synthase beta chain OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=trpB PE=3 SV=1 22 369 1.0E-38
sp|B6YSU5|TRPB_THEON Tryptophan synthase beta chain OS=Thermococcus onnurineus (strain NA1) GN=trpB PE=3 SV=1 25 369 3.0E-38
sp|Q5JDJ1|TRPB2_THEKO Tryptophan synthase beta chain 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=trpB2 PE=3 SV=1 22 369 3.0E-37
sp|Q9V150|TRPB2_PYRAB Tryptophan synthase beta chain 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=trpB2 PE=3 SV=2 23 369 2.0E-36
sp|O27520|TRPB2_METTH Tryptophan synthase beta chain 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trpB2 PE=3 SV=1 23 369 4.0E-36
sp|C5A1P4|TRPB_THEGJ Tryptophan synthase beta chain OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=trpB PE=3 SV=1 25 369 4.0E-36
sp|A1RVT1|TRPB_PYRIL Tryptophan synthase beta chain OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=trpB PE=3 SV=1 22 375 5.0E-36
sp|Q9WZ09|TRPB2_THEMA Tryptophan synthase beta chain 2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpB2 PE=3 SV=1 8 364 5.0E-35
sp|Q9Y8T5|TRPB1_AERPE Tryptophan synthase beta chain 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=trpB1 PE=3 SV=1 23 369 5.0E-35
sp|B7IHA8|TRPB_THEAB Tryptophan synthase beta chain OS=Thermosipho africanus (strain TCF52B) GN=trpB PE=3 SV=1 9 364 1.0E-34
sp|P50383|TRPB1_SULSO Tryptophan synthase beta chain 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=trpB1 PE=3 SV=2 22 372 1.0E-33
sp|Q971Z5|TRPB1_SULTO Tryptophan synthase beta chain 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=trpB1 PE=3 SV=1 22 362 2.0E-33
sp|O29028|TRPB2_ARCFU Tryptophan synthase beta chain 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=trpB2 PE=3 SV=1 22 369 4.0E-32
sp|O67409|TRPB2_AQUAE Tryptophan synthase beta chain 2 OS=Aquifex aeolicus (strain VF5) GN=trpB2 PE=3 SV=1 31 364 6.0E-32
sp|A7HMG8|TRPB_FERNB Tryptophan synthase beta chain OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=trpB PE=3 SV=1 22 368 9.0E-32
sp|Q9Y9H2|TRPB2_AERPE Tryptophan synthase beta chain 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=trpB2 PE=3 SV=1 22 369 6.0E-31
sp|A8F8F7|TRPB_PSELT Tryptophan synthase beta chain OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=trpB PE=3 SV=1 22 364 1.0E-30
sp|Q6L271|TRPB_PICTO Tryptophan synthase beta chain OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=trpB PE=3 SV=1 28 367 2.0E-29
sp|Q97TX6|TRPB2_SULSO Tryptophan synthase beta chain 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=trpB2 PE=1 SV=1 28 371 2.0E-28
sp|Q970N1|TRPB2_SULTO Tryptophan synthase beta chain 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=trpB2 PE=3 SV=2 22 369 2.0E-28
sp|Q9HKD2|TRPB_THEAC Tryptophan synthase beta chain OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=trpB PE=3 SV=1 18 369 9.0E-28
sp|Q8Q001|TRPB2_METMA Tryptophan synthase beta chain 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=trpB2 PE=3 SV=1 31 364 3.0E-25
sp|B8D4P0|TRPB_DESK1 Tryptophan synthase beta chain OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=trpB PE=3 SV=1 31 364 1.0E-24
sp|Q8TL44|TRPB2_METAC Tryptophan synthase beta chain 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=trpB2 PE=3 SV=1 31 364 6.0E-24
sp|Q97A51|TRPB_THEVO Tryptophan synthase beta chain OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=trpB PE=3 SV=1 27 369 3.0E-23
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10990
MDCLSQLEDGFNKIKEDPAFWEEYRSYYDYMGRPSRLHLAERLTEHAGGANIWLKREDLNHTGSHKINNALGQLL
LAKRLGKKKIIAETGAGQHGVATATVCARFGMECTVYMGAEDVRRQALNVFRMRLLGAKVVAVEAGSKTLRDAVN
EALRAWVVELDTTHYIIGSAIGPHPFPTIVRTFQSVIGNETKKQMMEQRGKLPDAVVACVGGGSNAVGMFHPFEN
DASVKLLGVEAGGDGIDTARHSATLTGGSKGVLHGVRTYVLQDKHGQISETHSVSAGLDYPGVGPELSSWKDSQR
AKFIAATDAQAFTAFRLMSQLEGIIPALESAHGIHGAIELAKTLKKEDDIVICLSGRGDKDVQSVADELPKIGPH
IGWDLRF*
Coding >Hirsu2|10990
ATGGACTGTCTCTCCCAGCTCGAGGACGGTTTCAACAAGATCAAAGAAGATCCAGCGTTCTGGGAGGAATATCGA
TCCTACTACGACTACATGGGCCGGCCATCGCGACTTCATCTAGCCGAGCGGCTGACGGAACACGCTGGCGGTGCC
AACATTTGGCTGAAGAGGGAAGACCTGAACCACACCGGCAGTCACAAGATCAACAATGCCCTTGGACAACTTTTG
CTGGCAAAGAGACTCGGCAAGAAGAAAATCATAGCCGAAACTGGTGCTGGACAGCACGGCGTTGCTACAGCTACT
GTGTGTGCTAGATTTGGAATGGAGTGCACTGTTTACATGGGAGCGGAGGATGTCCGGCGACAGGCTCTGAACGTG
TTTCGGATGAGACTGTTGGGAGCCAAAGTCGTGGCCGTTGAGGCAGGCAGCAAGACCTTGCGCGACGCGGTGAAC
GAGGCCCTCCGTGCCTGGGTAGTCGAACTCGACACGACGCACTACATTATTGGGTCCGCCATTGGCCCTCATCCC
TTCCCGACCATCGTGCGCACGTTTCAGTCAGTCATAGGCAATGAGACGAAGAAGCAAATGATGGAACAACGCGGC
AAGCTCCCGGACGCAGTAGTCGCTTGCGTTGGGGGGGGAAGCAATGCCGTCGGAATGTTCCACCCCTTCGAGAAC
GACGCCAGCGTGAAGCTCCTCGGCGTCGAAGCGGGTGGCGATGGCATCGATACCGCAAGACACAGTGCTACCCTG
ACGGGCGGCTCCAAGGGCGTCCTTCACGGCGTAAGGACATATGTGCTGCAGGATAAGCACGGGCAAATTTCCGAG
ACGCACTCCGTCTCAGCCGGCCTCGACTATCCTGGCGTCGGCCCGGAGTTGAGCTCCTGGAAGGATAGCCAAAGA
GCCAAGTTTATCGCCGCCACAGATGCTCAGGCCTTCACCGCCTTTAGACTCATGAGTCAGCTTGAGGGCATTATC
CCGGCGCTTGAATCTGCACATGGAATCCATGGCGCGATCGAGCTGGCCAAGACATTAAAGAAGGAAGATGACATT
GTCATTTGCCTGAGCGGCAGAGGCGATAAGGACGTACAGAGCGTGGCGGACGAGTTACCAAAGATCGGGCCGCAT
ATTGGCTGGGACTTAAGATTTTAG
Transcript >Hirsu2|10990
ATGGACTGTCTCTCCCAGCTCGAGGACGGTTTCAACAAGATCAAAGAAGATCCAGCGTTCTGGGAGGAATATCGA
TCCTACTACGACTACATGGGCCGGCCATCGCGACTTCATCTAGCCGAGCGGCTGACGGAACACGCTGGCGGTGCC
AACATTTGGCTGAAGAGGGAAGACCTGAACCACACCGGCAGTCACAAGATCAACAATGCCCTTGGACAACTTTTG
CTGGCAAAGAGACTCGGCAAGAAGAAAATCATAGCCGAAACTGGTGCTGGACAGCACGGCGTTGCTACAGCTACT
GTGTGTGCTAGATTTGGAATGGAGTGCACTGTTTACATGGGAGCGGAGGATGTCCGGCGACAGGCTCTGAACGTG
TTTCGGATGAGACTGTTGGGAGCCAAAGTCGTGGCCGTTGAGGCAGGCAGCAAGACCTTGCGCGACGCGGTGAAC
GAGGCCCTCCGTGCCTGGGTAGTCGAACTCGACACGACGCACTACATTATTGGGTCCGCCATTGGCCCTCATCCC
TTCCCGACCATCGTGCGCACGTTTCAGTCAGTCATAGGCAATGAGACGAAGAAGCAAATGATGGAACAACGCGGC
AAGCTCCCGGACGCAGTAGTCGCTTGCGTTGGGGGGGGAAGCAATGCCGTCGGAATGTTCCACCCCTTCGAGAAC
GACGCCAGCGTGAAGCTCCTCGGCGTCGAAGCGGGTGGCGATGGCATCGATACCGCAAGACACAGTGCTACCCTG
ACGGGCGGCTCCAAGGGCGTCCTTCACGGCGTAAGGACATATGTGCTGCAGGATAAGCACGGGCAAATTTCCGAG
ACGCACTCCGTCTCAGCCGGCCTCGACTATCCTGGCGTCGGCCCGGAGTTGAGCTCCTGGAAGGATAGCCAAAGA
GCCAAGTTTATCGCCGCCACAGATGCTCAGGCCTTCACCGCCTTTAGACTCATGAGTCAGCTTGAGGGCATTATC
CCGGCGCTTGAATCTGCACATGGAATCCATGGCGCGATCGAGCTGGCCAAGACATTAAAGAAGGAAGATGACATT
GTCATTTGCCTGAGCGGCAGAGGCGATAAGGACGTACAGAGCGTGGCGGACGAGTTACCAAAGATCGGGCCGCAT
ATTGGCTGGGACTTAAGATTTTAG
Gene >Hirsu2|10990
ATGGACTGTCTCTCCCAGCTCGAGGACGGTTTCAACAAGATCAAAGAAGATCCAGCGTTCTGGGAGGAATATCGA
TCCTACTACGACTACATGGGCCGGCCATCGCGACTTCATCTAGCCGAGCGGCTGACGGAACACGCTGGCGGTGCC
AACATTTGGCTGAAGAGGGAAGACCTGAACCACACCGGCAGTCACAAGATCAACAATGCCCTTGGACAACTTTTG
CTGGCAAAGAGACTCGGCAAGAAGAAAATCATAGCCGAAACTGGTGCTGGACAGCACGGCGTTGCTACAGCTACT
GTGTGTGCTAGATTTGGAATGGAGTGCACTGTTTACATGGGAGCGGTTGGTTTGACCAGCTTCAGACAGTATCCT
GTTGCGAACCCCTCACTGACAATGAGCAGGAGGATGTCCGGCGACAGGCTCTGAACGTGTTTCGGATGAGACTGT
TGGGAGCCAAAGTCGTGGCCGTTGAGGCAGGCAGCAAGACCTTGCGCGACGCGGTGAACGAGGCCCTCCGTGCCT
GGGTAGTCGAACTCGACACGACGCACTACATTATTGGGTCCGCCATTGGCCCTCATCCCTTCCCGACCATCGTGC
GCACGTTTCAGTCAGTCATAGGCAATGAGACGAAGAAGCAAATGATGGAACAACGCGGCAAGCTCCCGGACGCAG
TAGTCGCTTGCGTTGGGGGGGGAAGCAATGCCGTCGGAATGTTCCACCCCTTCGAGAACGACGCCAGCGTGAAGC
TCCTCGGCGTCGAAGCGGGTGGCGATGGCATCGATACCGCAAGACACAGTGCTACCCTGACGGGCGGCTCCAAGG
GCGTCCTTCACGGCGTAAGGACATATGTGCTGCAGGATAAGCACGGGCAAATTTCCGAGACGCACTCCGTCTCAG
CCGGCCTCGACTATCCTGGCGTCGGCCCGGAGTTGAGCTCCTGGAAGGATAGCCAAAGAGCCAAGTTTATCGCCG
CCACAGATGCTCAGGCCTTCACCGCCTTTAGACTCATGAGTCAGCTTGAGGGCATTATCCCGGCGCTTGAATCTG
CACATGGAATCCATGGCGCGATCGAGCTGGCCAAGACATTAAAGAAGGAAGATGACATTGTCATTTGCCTGAGCG
GCAGAGGCGATAAGGACGTACAGAGCGTGGCGGACGAGTTACCAAAGATCGGGCCGCATATTGGCTGGGACTTAA
GATTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail