Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1099
Gene name
LocationContig_123:32510..33522
Strand-
Gene length (bp)1012
Transcript length (bp)801
Coding sequence length (bp)801
Protein length (aa) 267

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03746 LamB_YcsF LamB/YcsF family 6.6E-80 13 257

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38096|LAMB_EMENI Lactam utilization protein lamB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lamB PE=2 SV=2 10 263 1.0E-65
sp|B9DKJ7|Y2038_STACT UPF0271 protein Sca_2038 OS=Staphylococcus carnosus (strain TM300) GN=Sca_2038 PE=3 SV=1 13 255 3.0E-56
sp|Q4L6V2|Y1314_STAHJ UPF0271 protein SH1314 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1314 PE=3 SV=1 13 255 5.0E-56
sp|Q2FXX2|Y1708_STAA8 UPF0271 protein SAOUHSC_01708 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_01708 PE=3 SV=1 13 257 2.0E-52
sp|Q5HFF7|Y1660_STAAC UPF0271 protein SACOL1660 OS=Staphylococcus aureus (strain COL) GN=SACOL1660 PE=3 SV=1 13 257 2.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38096|LAMB_EMENI Lactam utilization protein lamB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lamB PE=2 SV=2 10 263 1.0E-65
sp|B9DKJ7|Y2038_STACT UPF0271 protein Sca_2038 OS=Staphylococcus carnosus (strain TM300) GN=Sca_2038 PE=3 SV=1 13 255 3.0E-56
sp|Q4L6V2|Y1314_STAHJ UPF0271 protein SH1314 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1314 PE=3 SV=1 13 255 5.0E-56
sp|Q2FXX2|Y1708_STAA8 UPF0271 protein SAOUHSC_01708 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_01708 PE=3 SV=1 13 257 2.0E-52
sp|Q5HFF7|Y1660_STAAC UPF0271 protein SACOL1660 OS=Staphylococcus aureus (strain COL) GN=SACOL1660 PE=3 SV=1 13 257 2.0E-52
sp|A8Z4E3|Y1605_STAAT UPF0271 protein USA300HOU_1605 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=USA300HOU_1605 PE=3 SV=1 13 257 2.0E-52
sp|Q2FGC1|Y1562_STAA3 UPF0271 protein SAUSA300_1562 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1562 PE=3 SV=1 13 257 2.0E-52
sp|A6QHE6|Y1506_STAAE UPF0271 protein NWMN_1506 OS=Staphylococcus aureus (strain Newman) GN=NWMN_1506 PE=3 SV=1 13 257 2.0E-52
sp|Q2YT73|Y1476_STAAB UPF0271 protein SAB1476c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1476c PE=3 SV=1 13 257 2.0E-52
sp|Q8CSB6|Y1287_STAES UPF0271 protein SE_1287 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1287 PE=3 SV=1 12 255 2.0E-52
sp|Q5HNU6|Y1168_STAEQ UPF0271 protein SERP1168 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1168 PE=3 SV=1 12 255 2.0E-52
sp|O58714|Y986_PYRHO UPF0271 protein PH0986 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0986 PE=1 SV=1 13 258 2.0E-52
sp|Q8NW95|Y1555_STAAW UPF0271 protein MW1555 OS=Staphylococcus aureus (strain MW2) GN=MW1555 PE=3 SV=1 13 257 3.0E-52
sp|Q6G8W4|Y1541_STAAS UPF0271 protein SAS1541 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1541 PE=3 SV=1 13 257 3.0E-52
sp|A6U274|Y1696_STAA2 UPF0271 protein SaurJH1_1696 OS=Staphylococcus aureus (strain JH1) GN=SaurJH1_1696 PE=3 SV=1 13 257 3.0E-52
sp|A5ITD0|Y1662_STAA9 UPF0271 protein SaurJH9_1662 OS=Staphylococcus aureus (strain JH9) GN=SaurJH9_1662 PE=3 SV=1 13 257 3.0E-52
sp|P67622|Y1605_STAAM UPF0271 protein SAV1605 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1605 PE=3 SV=1 13 257 3.0E-52
sp|A7X313|Y1592_STAA1 UPF0271 protein SAHV_1592 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=SAHV_1592 PE=3 SV=1 13 257 3.0E-52
sp|P67623|Y1433_STAAN UPF0271 protein SA1433 OS=Staphylococcus aureus (strain N315) GN=SA1433 PE=3 SV=1 13 257 3.0E-52
sp|B2A1I6|Y1143_NATTJ UPF0271 protein Nther_1143 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=Nther_1143 PE=3 SV=1 11 257 4.0E-52
sp|Q6GG98|Y1684_STAAR UPF0271 protein SAR1684 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1684 PE=3 SV=1 13 257 5.0E-52
sp|Q18BQ3|Y1384_PEPD6 UPF0271 protein CD630_13840 OS=Peptoclostridium difficile (strain 630) GN=CD630_13840 PE=3 SV=1 13 255 6.0E-52
sp|Q49Y42|Y1157_STAS1 UPF0271 protein SSP1157 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1157 PE=3 SV=1 13 255 2.0E-51
sp|Q9V005|Y993_PYRAB UPF0271 protein PYRAB09930 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB09930 PE=3 SV=1 13 258 3.0E-51
sp|B7JE03|Y3100_BACC0 UPF0271 protein BCAH820_3100 OS=Bacillus cereus (strain AH820) GN=BCAH820_3100 PE=3 SV=1 13 265 6.0E-51
sp|C3P0S0|Y3146_BACAA UPF0271 protein BAA_3146 OS=Bacillus anthracis (strain A0248) GN=BAA_3146 PE=3 SV=1 13 265 1.0E-50
sp|Q81NT0|Y3095_BACAN UPF0271 protein BA_3095/GBAA_3095/BAS2880 OS=Bacillus anthracis GN=BA_3095 PE=3 SV=1 13 265 1.0E-50
sp|Q9I626|Y492_PSEAE UPF0271 protein PA0492 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA0492 PE=3 SV=1 13 259 2.0E-50
sp|Q7ME92|Y4778_VIBVY UPF0271 protein VVA0778 OS=Vibrio vulnificus (strain YJ016) GN=VVA0778 PE=3 SV=2 13 250 2.0E-50
sp|A5EZN1|Y716_VIBC3 UPF0271 protein VC0395_0716/VC395_A0539 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=VC0395_0716 PE=3 SV=1 9 258 2.0E-50
sp|Q9KLG8|Y3576_VIBCH UPF0271 protein VC_A0776 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_A0776 PE=3 SV=1 9 258 2.0E-50
sp|C3LW40|Y3535_VIBCM UPF0271 protein VCM66_A0735 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=VCM66_A0735 PE=3 SV=1 9 258 2.0E-50
sp|Q8D788|Y4273_VIBVU UPF0271 protein VV2_0273 OS=Vibrio vulnificus (strain CMCP6) GN=VV2_0273 PE=3 SV=2 13 250 3.0E-50
sp|A6TSF8|Y2977_ALKMQ UPF0271 protein Amet_2977 OS=Alkaliphilus metalliredigens (strain QYMF) GN=Amet_2977 PE=3 SV=1 13 257 5.0E-50
sp|Q1QYS2|Y1029_CHRSD UPF0271 protein Csal_1029 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=Csal_1029 PE=3 SV=1 15 263 6.0E-50
sp|C6A2E8|Y730_THESM UPF0271 protein TSIB_0730 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=TSIB_0730 PE=3 SV=1 13 255 8.0E-50
sp|Q6HH05|Y2847_BACHK UPF0271 protein BT9727_2847 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_2847 PE=3 SV=1 13 249 1.0E-49
sp|C1F030|Y3156_BACC3 UPF0271 protein BCA_3156 OS=Bacillus cereus (strain 03BB102) GN=BCA_3156 PE=3 SV=1 13 249 2.0E-49
sp|C3LDU8|Y1513_BACAC UPF0271 protein BAMEG_1513 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=BAMEG_1513 PE=3 SV=1 13 265 2.0E-49
sp|B9E7M7|Y1488_MACCJ UPF0271 protein MCCL_1488 OS=Macrococcus caseolyticus (strain JCSC5402) GN=MCCL_1488 PE=3 SV=1 13 263 4.0E-49
sp|A9VKB0|Y2872_BACWK UPF0271 protein BcerKBAB4_2872 OS=Bacillus weihenstephanensis (strain KBAB4) GN=BcerKBAB4_2872 PE=3 SV=1 13 249 4.0E-49
sp|Q8U1D7|Y1272_PYRFU UPF0271 protein PF1272 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1272 PE=3 SV=1 13 266 6.0E-49
sp|B7HVU6|Y3118_BACC7 UPF0271 protein BCAH187_A3118 OS=Bacillus cereus (strain AH187) GN=BCAH187_A3118 PE=3 SV=1 13 249 8.0E-49
sp|B9J590|Y2904_BACCQ UPF0271 protein BCQ_2904 OS=Bacillus cereus (strain Q1) GN=BCQ_2904 PE=3 SV=1 13 249 8.0E-49
sp|Q735N3|Y3119_BACC1 UPF0271 protein BCE_3119 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_3119 PE=3 SV=1 13 249 1.0E-48
sp|B7H8H6|Y3086_BACC4 UPF0271 protein BCB4264_A3086 OS=Bacillus cereus (strain B4264) GN=BCB4264_A3086 PE=3 SV=1 11 249 1.0E-48
sp|A7Z1F1|Y428_BACMF UPF0271 protein RBAM_004280 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=RBAM_004280 PE=3 SV=1 13 242 2.0E-48
sp|Q639M2|Y2808_BACCZ UPF0271 protein BCE33L2808 OS=Bacillus cereus (strain ZK / E33L) GN=BCE33L2808 PE=3 SV=1 13 249 3.0E-48
sp|A8FA07|Y379_BACP2 UPF0271 protein BPUM_0379 OS=Bacillus pumilus (strain SAFR-032) GN=BPUM_0379 PE=3 SV=1 13 242 4.0E-48
sp|Q7WF01|Y4479_BORBR UPF0271 protein BB4479 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=BB4479 PE=3 SV=1 13 246 6.0E-48
sp|Q7W3M5|Y4006_BORPA UPF0271 protein BPP4006 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=BPP4006 PE=3 SV=1 13 246 6.0E-48
sp|B6YWS6|Y1051_THEON UPF0271 protein TON_1051 OS=Thermococcus onnurineus (strain NA1) GN=TON_1051 PE=3 SV=1 13 258 7.0E-48
sp|O30444|Y150_BORPE UPF0271 protein BP0150 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=BP0150 PE=3 SV=1 13 246 7.0E-48
sp|Q3SSH7|Y1503_NITWN UPF0271 protein Nwi_1503 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=Nwi_1503 PE=3 SV=1 13 257 2.0E-47
sp|Q81BT0|Y3066_BACCR UPF0271 protein BC_3066 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_3066 PE=3 SV=1 13 249 2.0E-47
sp|Q5JG28|Y336_THEKO UPF0271 protein TK0336 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0336 PE=3 SV=1 13 258 3.0E-47
sp|Q6N6D6|Y2681_RHOPA UPF0271 protein RPA2681 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=RPA2681 PE=3 SV=1 13 256 6.0E-47
sp|A6LX30|Y2759_CLOB8 UPF0271 protein Cbei_2759 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=Cbei_2759 PE=3 SV=1 13 266 7.0E-47
sp|Q9PMC8|Y1541_CAMJE UPF0271 protein Cj1541 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=Cj1541 PE=3 SV=1 12 266 9.0E-47
sp|A1W1E0|Y1526_CAMJJ UPF0271 protein CJJ81176_1526 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=CJJ81176_1526 PE=3 SV=1 12 266 9.0E-47
sp|Q9RYM7|Y2984_DEIRA UPF0271 protein DR_A0284 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_A0284 PE=3 SV=2 13 265 1.0E-46
sp|B3QJF8|Y2956_RHOPT UPF0271 protein Rpal_2956 OS=Rhodopseudomonas palustris (strain TIE-1) GN=Rpal_2956 PE=3 SV=1 13 256 2.0E-46
sp|B5Y6A9|Y1531_COPPD UPF0271 protein COPRO5265_1531 OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=COPRO5265_1531 PE=3 SV=1 13 255 2.0E-46
sp|Q5HSP5|Y1712_CAMJR UPF0271 protein CJE1712 OS=Campylobacter jejuni (strain RM1221) GN=CJE1712 PE=3 SV=1 12 266 2.0E-46
sp|Q89P49|Y3634_BRADU UPF0271 protein blr3634 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr3634 PE=3 SV=1 13 266 4.0E-46
sp|Q8R9J9|Y1608_CALS4 UPF0271 protein TTE1608 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1608 PE=3 SV=1 13 266 4.0E-46
sp|A7GQB8|Y2060_BACCN UPF0271 protein Bcer98_2060 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=Bcer98_2060 PE=3 SV=1 13 249 4.0E-46
sp|Q65NB0|Y498_BACLD UPF0271 protein BLi00498/BL02806 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=BLi00498 PE=3 SV=1 13 246 8.0E-46
sp|A7N8I1|Y5795_VIBCB UPF0271 protein VIBHAR_05795 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=VIBHAR_05795 PE=3 SV=1 6 255 8.0E-46
sp|A8FNK1|Y1440_CAMJ8 UPF0271 protein C8J_1440 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=C8J_1440 PE=3 SV=1 12 266 8.0E-46
sp|Q9RL45|Y441_STRCO UPF0271 protein SCO0441 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0441 PE=3 SV=1 13 258 8.0E-46
sp|A4IN19|Y1353_GEOTN UPF0271 protein GTNG_1353 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=GTNG_1353 PE=3 SV=1 11 188 9.0E-46
sp|B9LC61|Y1437_CHLSY UPF0271 protein Chy400_1437 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=Chy400_1437 PE=3 SV=1 13 255 1.0E-45
sp|A9W9Q7|Y1315_CHLAA UPF0271 protein Caur_1315 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=Caur_1315 PE=3 SV=1 13 255 1.0E-45
sp|Q881F7|Y2936_PSESM UPF0271 protein PSPTO_2936 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=PSPTO_2936 PE=3 SV=1 13 263 2.0E-45
sp|Q88IS9|Y2920_PSEPK UPF0271 protein PP_2920 OS=Pseudomonas putida (strain KT2440) GN=PP_2920 PE=3 SV=1 11 258 3.0E-45
sp|Q6AB26|Y282_PROAC UPF0271 protein PPA0282 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=PPA0282 PE=3 SV=1 13 255 4.0E-45
sp|A7H5Q5|Y1899_CAMJD UPF0271 protein JJD26997_1899 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=JJD26997_1899 PE=3 SV=1 12 266 5.0E-45
sp|C0ZCX3|Y2655_BREBN UPF0271 protein BBR47_26550 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=BBR47_26550 PE=3 SV=1 11 259 7.0E-45
sp|Q87HS9|Y4877_VIBPA UPF0271 protein VPA0877 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VPA0877 PE=3 SV=1 6 255 1.0E-44
sp|Q136X6|Y2634_RHOPS UPF0271 protein RPD_2634 OS=Rhodopseudomonas palustris (strain BisB5) GN=RPD_2634 PE=3 SV=1 13 249 1.0E-44
sp|Q746B8|Y2237_THET2 UPF0271 protein TT_P0137 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_P0137 PE=3 SV=1 13 258 1.0E-44
sp|Q9HVR0|Y4511_PSEAE UPF0271 protein PA4511 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA4511 PE=1 SV=1 11 260 2.0E-44
sp|A5N106|Y2790_CLOK5 UPF0271 protein CKL_2790 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=CKL_2790 PE=3 SV=1 13 250 4.0E-44
sp|B9E4V7|Y2481_CLOK1 UPF0271 protein CKR_2481 OS=Clostridium kluyveri (strain NBRC 12016) GN=CKR_2481 PE=3 SV=1 13 250 4.0E-44
sp|Q1QLQ7|Y2042_NITHX UPF0271 protein Nham_2042 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=Nham_2042 PE=3 SV=1 13 257 4.0E-44
sp|B8GBN6|Y1958_CHLAD UPF0271 protein Cagg_1958 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=Cagg_1958 PE=3 SV=1 13 244 6.0E-44
sp|Q53WG6|Y2695_THET8 UPF0271 protein TTHB195 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHB195 PE=1 SV=1 13 258 3.0E-43
sp|Q63NV1|Y4198_BURPS UPF0271 protein BPSS0198 OS=Burkholderia pseudomallei (strain K96243) GN=BPSS0198 PE=3 SV=1 13 257 4.0E-43
sp|Q7MZI3|Y4304_PHOLL UPF0271 protein plu4304 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=plu4304 PE=3 SV=2 13 249 6.0E-43
sp|P42963|YCSF_BACSU UPF0271 protein YcsF OS=Bacillus subtilis (strain 168) GN=ycsF PE=3 SV=4 13 242 6.0E-43
sp|A1K1F6|Y043_AZOSB UPF0271 protein azo0043 OS=Azoarcus sp. (strain BH72) GN=azo0043 PE=3 SV=1 13 248 9.0E-43
sp|Q2IW74|Y2834_RHOP2 UPF0271 protein RPB_2834 OS=Rhodopseudomonas palustris (strain HaA2) GN=RPB_2834 PE=3 SV=1 13 249 9.0E-43
sp|Q60BJ2|Y476_METCA UPF0271 protein MCA0476 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=MCA0476 PE=3 SV=1 10 247 1.0E-42
sp|C4LFU8|Y1858_TOLAT UPF0271 protein Tola_1858 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=Tola_1858 PE=3 SV=1 13 246 1.0E-42
sp|Q67LD9|Y2522_SYMTH UPF0271 protein STH2522 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=STH2522 PE=3 SV=1 11 250 2.0E-42
sp|Q8U920|Y3910_AGRFC UPF0271 protein Atu3910 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=Atu3910 PE=3 SV=1 13 263 4.0E-42
sp|B0VAY5|Y2441_ACIBY UPF0271 protein ABAYE2441 OS=Acinetobacter baumannii (strain AYE) GN=ABAYE2441 PE=3 SV=1 13 246 1.0E-41
sp|B7H4L9|Y2265_ACIB3 UPF0271 protein ABBFA_002265 OS=Acinetobacter baumannii (strain AB307-0294) GN=ABBFA_002265 PE=3 SV=1 13 246 1.0E-41
sp|B7IBY8|Y1453_ACIB5 UPF0271 protein AB57_1453 OS=Acinetobacter baumannii (strain AB0057) GN=AB57_1453 PE=3 SV=1 13 246 1.0E-41
sp|B2HXI0|Y1267_ACIBC UPF0271 protein ACICU_01267 OS=Acinetobacter baumannii (strain ACICU) GN=ACICU_01267 PE=3 SV=1 13 246 1.0E-41
sp|Q88E89|Y4577_PSEPK UPF0271 protein PP_4577 OS=Pseudomonas putida (strain KT2440) GN=PP_4577 PE=3 SV=1 15 260 1.0E-41
sp|B2GE66|Y1612_LACF3 UPF0271 protein LAF_1612 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=LAF_1612 PE=3 SV=1 13 255 2.0E-41
sp|Q89LH6|Y4568_BRADU UPF0271 protein blr4568 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr4568 PE=3 SV=1 11 266 3.0E-41
sp|A3M451|Y1267_ACIBT UPF0271 protein A1S_1267 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=A1S_1267 PE=3 SV=2 13 246 4.0E-41
sp|Q8EN13|Y2677_OCEIH UPF0271 protein OB2677 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB2677 PE=3 SV=1 13 246 6.0E-41
sp|Q9CCW2|Y333_MYCLE UPF0271 protein ML0333 OS=Mycobacterium leprae (strain TN) GN=ML0333 PE=3 SV=1 13 255 8.0E-41
sp|B8ZUB2|Y333_MYCLB UPF0271 protein MLBr00333 OS=Mycobacterium leprae (strain Br4923) GN=MLBr00333 PE=3 SV=1 13 255 8.0E-41
sp|Q214L4|Y2622_RHOPB UPF0271 protein RPC_2622 OS=Rhodopseudomonas palustris (strain BisB18) GN=RPC_2622 PE=3 SV=1 13 257 8.0E-41
sp|Q6CYM1|Y4486_PECAS UPF0271 protein ECA4486 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ECA4486 PE=3 SV=1 13 258 9.0E-41
sp|A0LNR3|Y3392_SYNFM UPF0271 protein Sfum_3392 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=Sfum_3392 PE=3 SV=1 14 258 1.0E-40
sp|Q3A9E0|Y2450_CARHZ UPF0271 protein CHY_2450 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=CHY_2450 PE=3 SV=1 11 258 1.0E-40
sp|Q5FUE6|Y211_GLUOX UPF0271 protein GOX0211 OS=Gluconobacter oxydans (strain 621H) GN=GOX0211 PE=3 SV=1 10 260 3.0E-40
sp|Q9KBV3|Y1821_BACHD UPF0271 protein BH1821 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH1821 PE=3 SV=1 13 250 3.0E-40
sp|Q7WEA9|Y4725_BORBR UPF0271 protein BB4725 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=BB4725 PE=3 SV=1 13 246 4.0E-40
sp|Q87UC7|Y5378_PSESM UPF0271 protein PSPTO_5378 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=PSPTO_5378 PE=3 SV=1 11 258 5.0E-40
sp|Q07M58|Y3039_RHOP5 UPF0271 protein RPE_3039 OS=Rhodopseudomonas palustris (strain BisA53) GN=RPE_3039 PE=3 SV=1 13 249 6.0E-40
sp|Q5WBF8|Y3770_BACSK UPF0271 protein ABC3770 OS=Bacillus clausii (strain KSM-K16) GN=ABC3770 PE=3 SV=1 13 247 8.0E-40
sp|Q8XRC2|Y4436_RALSO UPF0271 protein RSp0936 OS=Ralstonia solanacearum (strain GMI1000) GN=RSp0936 PE=3 SV=1 13 266 1.0E-39
sp|Q1LSC6|Y064_CUPMC UPF0271 protein Rmet_0064 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=Rmet_0064 PE=3 SV=1 13 200 1.0E-39
sp|A0PV23|Y4152_MYCUA UPF0271 protein MUL_4152 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_4152 PE=3 SV=1 6 255 2.0E-39
sp|Q6F9H7|Y2520_ACIAD UPF0271 protein ACIAD2520 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ACIAD2520 PE=3 SV=1 13 257 3.0E-39
sp|Q881H6|Y2917_PSESM UPF0271 protein PSPTO_2917 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=PSPTO_2917 PE=3 SV=1 13 258 4.0E-39
sp|Q3KGF8|Y1405_PSEPF UPF0271 protein Pfl01_1405 OS=Pseudomonas fluorescens (strain Pf0-1) GN=Pfl01_1405 PE=3 SV=1 15 266 4.0E-39
sp|Q827I5|Y6939_STRAW UPF0271 protein SAV_6939 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_6939 PE=3 SV=1 13 249 1.0E-38
sp|Q8FQQ3|Y1066_COREF UPF0271 protein CE1066 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE1066 PE=3 SV=1 13 258 1.0E-38
sp|A1TSY0|Y3513_ACIAC UPF0271 protein Aave_3513 OS=Acidovorax citrulli (strain AAC00-1) GN=Aave_3513 PE=3 SV=1 13 263 2.0E-38
sp|A0QAC2|Y580_MYCA1 UPF0271 protein MAV_0580 OS=Mycobacterium avium (strain 104) GN=MAV_0580 PE=3 SV=1 13 255 2.0E-38
sp|B1VKZ4|Y3193_STRGG UPF0271 protein SGR_3193 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=SGR_3193 PE=3 SV=1 13 244 3.0E-38
sp|A0JR24|Y093_ARTS2 UPF0271 protein Arth_0093 OS=Arthrobacter sp. (strain FB24) GN=Arth_0093 PE=3 SV=1 13 244 1.0E-37
sp|Q743V5|Y486_MYCPA UPF0271 protein MAP_0486c OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_0486c PE=3 SV=1 13 255 1.0E-37
sp|Q5LMA4|Y3659_RUEPO UPF0271 protein SPO3659 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=SPO3659 PE=3 SV=1 13 254 2.0E-37
sp|Q5YMT5|Y5654_NOCFA UPF0271 protein NFA_56540 OS=Nocardia farcinica (strain IFM 10152) GN=NFA_56540 PE=3 SV=1 12 257 2.0E-37
sp|Q8RG75|Y439_FUSNN UPF0271 protein FN0439 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=FN0439 PE=3 SV=1 13 265 3.0E-37
sp|Q9I203|Y2112_PSEAE UPF0271 protein PA2112 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA2112 PE=3 SV=1 15 196 6.0E-37
sp|Q8NRP4|Y1004_CORGL UPF0271 protein Cgl1004/cg1141 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=Cgl1004 PE=3 SV=1 13 250 6.0E-37
sp|A4QCX4|Y1095_CORGB UPF0271 protein cgR_1095 OS=Corynebacterium glutamicum (strain R) GN=cgR_1095 PE=3 SV=1 13 250 1.0E-36
sp|Q4KGJ3|Y1513_PSEF5 UPF0271 protein PFL_1513 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=PFL_1513 PE=3 SV=1 15 258 2.0E-36
sp|Q5KZU9|Y1502_GEOKA UPF0271 protein GK1502 OS=Geobacillus kaustophilus (strain HTA426) GN=GK1502 PE=3 SV=1 11 125 2.0E-36
sp|B2HJ17|Y5076_MYCMM UPF0271 protein MMAR_5076 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=MMAR_5076 PE=3 SV=1 6 255 3.0E-36
sp|B0TAN9|Y1066_HELMI UPF0271 protein Helmi_10660 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=Helmi_10660 PE=3 SV=1 13 244 1.0E-35
sp|Q477G2|Y089_CUPPJ UPF0271 protein Reut_A0089 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=Reut_A0089 PE=3 SV=1 13 200 3.0E-35
sp|B2AG42|Y068_CUPTR UPF0271 protein RALTA_A0068 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=RALTA_A0068 PE=3 SV=1 13 200 2.0E-34
sp|Q4JX93|Y407_CORJK UPF0271 protein jk0407 OS=Corynebacterium jeikeium (strain K411) GN=jk0407 PE=3 SV=1 5 246 3.0E-34
sp|B2GHI3|Y2112_KOCRD UPF0271 protein KRH_21120 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=KRH_21120 PE=3 SV=1 13 244 4.0E-34
sp|B2JIN1|Y2905_BURP8 UPF0271 protein Bphy_2905 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=Bphy_2905 PE=3 SV=1 13 246 6.0E-34
sp|Q8U822|Y4277_AGRFC UPF0271 protein Atu4277 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=Atu4277 PE=3 SV=2 13 258 7.0E-34
sp|Q13T51|Y4200_BURXL UPF0271 protein Bxeno_A4200 OS=Burkholderia xenovorans (strain LB400) GN=Bxeno_A4200 PE=3 SV=1 13 246 8.0E-34
sp|A4JIL2|Y3124_BURVG UPF0271 protein Bcep1808_3124 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=Bcep1808_3124 PE=3 SV=1 13 246 8.0E-34
sp|B2T6V9|Y3743_BURPP UPF0271 protein Bphyt_3743 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=Bphyt_3743 PE=3 SV=1 13 246 3.0E-33
sp|Q0KFE3|Y126_CUPNH UPF0271 protein H16_A0126 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=H16_A0126 PE=3 SV=1 13 191 3.0E-33
sp|Q220D5|Y870_RHOFT UPF0271 protein Rfer_0870 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=Rfer_0870 PE=3 SV=1 13 254 3.0E-33
sp|Q8XXE5|Y2169_RALSO UPF0271 protein RSc2169 OS=Ralstonia solanacearum (strain GMI1000) GN=RSc2169 PE=3 SV=1 13 263 6.0E-33
sp|A4T5K5|Y1451_MYCGI UPF0271 protein Mflv_1451 OS=Mycobacterium gilvum (strain PYR-GCK) GN=Mflv_1451 PE=3 SV=1 13 255 2.0E-32
sp|A9ABQ1|Y198_BURM1 UPF0271 protein Bmul_3034/BMULJ_00198 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=Bmul_3034 PE=3 SV=1 13 258 3.0E-32
sp|Q0BB33|Y3084_BURCM UPF0271 protein Bamb_3084 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=Bamb_3084 PE=3 SV=1 13 246 3.0E-32
sp|B1YPC1|Y2950_BURA4 UPF0271 protein BamMC406_2950 OS=Burkholderia ambifaria (strain MC40-6) GN=BamMC406_2950 PE=3 SV=1 13 246 3.0E-32
sp|Q39C36|Y6386_BURL3 UPF0271 protein Bcep18194_A6386 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=Bcep18194_A6386 PE=3 SV=1 13 246 5.0E-32
sp|Q2T213|Y228_BURTA UPF0271 protein BTH_I0228 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=BTH_I0228 PE=3 SV=1 13 258 5.0E-32
sp|Q63YD1|Y257_BURPS UPF0271 protein BPSL0257 OS=Burkholderia pseudomallei (strain K96243) GN=BPSL0257 PE=3 SV=1 13 258 2.0E-31
sp|Q7NT87|Y3173_CHRVO UPF0271 protein CV_3173 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=CV_3173 PE=3 SV=1 13 263 2.0E-31
sp|B1K0B1|Y3058_BURCC UPF0271 protein Bcenmc03_3058 OS=Burkholderia cenocepacia (strain MC0-3) GN=Bcenmc03_3058 PE=3 SV=1 13 246 4.0E-31
sp|A3MRJ9|Y5870_BURM7 UPF0271 protein BMA10247_3370 OS=Burkholderia mallei (strain NCTC 10247) GN=BMA10247_3370 PE=3 SV=1 13 258 1.0E-30
sp|A1V7S0|Y4778_BURMS UPF0271 protein BMASAVP1_A2978 OS=Burkholderia mallei (strain SAVP1) GN=BMASAVP1_A2978 PE=3 SV=1 13 258 1.0E-30
sp|A2S808|Y4413_BURM9 UPF0271 protein BMA10229_A2113 OS=Burkholderia mallei (strain NCTC 10229) GN=BMA10229_A2113 PE=3 SV=1 13 258 1.0E-30
sp|Q62EU9|Y3309_BURMA UPF0271 protein BMA3309 OS=Burkholderia mallei (strain ATCC 23344) GN=BMA3309 PE=3 SV=1 13 258 1.0E-30
sp|B2VBP4|Y2314_ERWT9 UPF0271 protein ETA_23140 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ETA_23140 PE=3 SV=1 13 246 2.0E-30
sp|A5UBF2|Y3400_HAEIE UPF0271 protein CGSHiEE_03400 OS=Haemophilus influenzae (strain PittEE) GN=CGSHiEE_03400 PE=3 SV=1 11 250 6.0E-30
sp|Q4QJL8|Y2036_HAEI8 UPF0271 protein NTHI2036 OS=Haemophilus influenzae (strain 86-028NP) GN=NTHI2036 PE=3 SV=1 11 250 6.0E-30
sp|A1JR39|Y2953_YERE8 UPF0271 protein YE2953 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=YE2953 PE=3 SV=1 13 265 8.0E-30
sp|P45347|Y1729_HAEIN UPF0271 protein HI_1729 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1729 PE=1 SV=2 11 250 1.0E-29
sp|A6W5D5|Y535_KINRD UPF0271 protein Krad_0535 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=Krad_0535 PE=3 SV=1 13 266 2.0E-29
sp|A5UFG0|Y2380_HAEIG UPF0271 protein CGSHiGG_02380 OS=Haemophilus influenzae (strain PittGG) GN=CGSHiGG_02380 PE=3 SV=1 11 250 2.0E-29
sp|A8HRP6|Y4074_AZOC5 UPF0271 protein AZC_4074 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=AZC_4074 PE=3 SV=1 13 255 2.0E-29
sp|A9MJN1|YBGL_SALAR UPF0271 protein YbgL OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ybgL PE=3 SV=1 13 265 6.0E-29
sp|B2U8X6|Y2372_RALPJ UPF0271 protein Rpic_2372 OS=Ralstonia pickettii (strain 12J) GN=Rpic_2372 PE=3 SV=1 13 199 6.0E-29
sp|A9R3Y2|Y3591_YERPG UPF0271 protein YpAngola_A3591 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=YpAngola_A3591 PE=3 SV=1 13 199 7.0E-29
sp|B2KA67|Y3021_YERPB UPF0271 protein YPTS_3021 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=YPTS_3021 PE=3 SV=1 13 199 7.0E-29
sp|Q667T3|Y2908_YERPS UPF0271 protein YPTB2908 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=YPTB2908 PE=3 SV=2 13 199 7.0E-29
sp|Q8ZD89|Y2700_YERPE UPF0271 protein YPO2700/y1276/YP_2504 OS=Yersinia pestis GN=YPO2700 PE=3 SV=1 13 199 7.0E-29
sp|Q1C575|Y2432_YERPA UPF0271 protein YPA_2432 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=YPA_2432 PE=3 SV=1 13 199 7.0E-29
sp|A4TKZ6|Y1571_YERPP UPF0271 protein YPDSF_1571 OS=Yersinia pestis (strain Pestoides F) GN=YPDSF_1571 PE=3 SV=1 13 199 7.0E-29
sp|Q1CKG2|Y1188_YERPN UPF0271 protein YPN_1188 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=YPN_1188 PE=3 SV=1 13 199 7.0E-29
sp|B1JRA7|Y1169_YERPY UPF0271 protein YPK_1169 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=YPK_1169 PE=3 SV=1 13 199 7.0E-29
sp|A7FFS0|Y1117_YERP3 UPF0271 protein YpsIP31758_1117 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=YpsIP31758_1117 PE=3 SV=1 13 199 7.0E-29
sp|A8AJA9|Y2455_CITK8 UPF0271 protein CKO_02455 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=CKO_02455 PE=3 SV=1 13 242 2.0E-28
sp|A8GB71|Y1257_SERP5 UPF0271 protein Spro_1257 OS=Serratia proteamaculans (strain 568) GN=Spro_1257 PE=3 SV=1 13 191 2.0E-28
sp|B5XZE1|Y3846_KLEP3 UPF0271 protein KPK_3846 OS=Klebsiella pneumoniae (strain 342) GN=KPK_3846 PE=3 SV=1 13 246 6.0E-28
sp|A6T6E6|Y706_KLEP7 UPF0271 protein KPN78578_07060 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=KPN78578_07060 PE=3 SV=1 13 261 7.0E-28
sp|B0UWY1|Y1920_HISS2 UPF0271 protein HSM_1920 OS=Histophilus somni (strain 2336) GN=HSM_1920 PE=3 SV=1 11 242 1.0E-27
sp|C6DCC6|Y1228_PECCP UPF0271 protein PC1_1228 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=PC1_1228 PE=3 SV=1 13 246 2.0E-27
sp|P0A0Z2|Y228_NEIMB UPF0271 protein rni3 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rni3 PE=3 SV=1 11 247 3.0E-27
sp|A1KRR2|Y227_NEIMF UPF0271 protein NMC0227 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=NMC0227 PE=3 SV=1 11 247 3.0E-27
sp|P0A0Z1|Y030_NEIMA UPF0271 protein rni3 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rni3 PE=3 SV=1 11 247 3.0E-27
sp|Q0I195|Y027_HAES1 UPF0271 protein HS_0027 OS=Haemophilus somnus (strain 129Pt) GN=HS_0027 PE=3 SV=1 11 242 6.0E-27
sp|A9M3F3|Y1916_NEIM0 UPF0271 protein NMCC_1916 OS=Neisseria meningitidis serogroup C (strain 053442) GN=NMCC_1916 PE=3 SV=1 11 247 1.0E-26
sp|A7MQV7|Y2634_CROS8 UPF0271 protein ESA_02634 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ESA_02634 PE=3 SV=1 13 258 8.0E-26
sp|B4TQ30|YBGL_SALSV UPF0271 protein YbgL OS=Salmonella schwarzengrund (strain CVM19633) GN=ybgL PE=3 SV=1 13 265 1.0E-25
sp|B5EZF1|YBGL_SALA4 UPF0271 protein YbgL OS=Salmonella agona (strain SL483) GN=ybgL PE=3 SV=1 13 265 3.0E-25
sp|B4SZB9|YBGL_SALNS UPF0271 protein YbgL OS=Salmonella newport (strain SL254) GN=ybgL PE=3 SV=1 13 265 4.0E-25
sp|B7N9V2|YBGL_ECOLU UPF0271 protein YbgL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ybgL PE=3 SV=1 13 191 4.0E-25
sp|B5R678|YBGL_SALG2 UPF0271 protein YbgL OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ybgL PE=3 SV=1 13 265 5.0E-25
sp|B5QWF7|YBGL_SALEP UPF0271 protein YbgL OS=Salmonella enteritidis PT4 (strain P125109) GN=ybgL PE=3 SV=1 13 265 5.0E-25
sp|B5FNE9|YBGL_SALDC UPF0271 protein YbgL OS=Salmonella dublin (strain CT_02021853) GN=ybgL PE=3 SV=1 13 265 5.0E-25
sp|B4TBB5|YBGL_SALHS UPF0271 protein YbgL OS=Salmonella heidelberg (strain SL476) GN=ybgL PE=3 SV=1 13 265 2.0E-24
sp|Q8ZQV6|YBGL_SALTY UPF0271 protein YbgL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ybgL PE=3 SV=1 13 265 2.0E-24
sp|B1LLF0|YBGL_ECOSM UPF0271 protein YbgL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ybgL PE=3 SV=1 13 242 2.0E-24
sp|Q8Z8D9|YBGL_SALTI UPF0271 protein YbgL OS=Salmonella typhi GN=ybgL PE=3 SV=1 13 265 3.0E-24
sp|Q57RM2|YBGL_SALCH UPF0271 protein YbgL OS=Salmonella choleraesuis (strain SC-B67) GN=ybgL PE=3 SV=2 13 265 3.0E-24
sp|P75746|YBGL_ECOLI UPF0271 protein YbgL OS=Escherichia coli (strain K12) GN=ybgL PE=1 SV=1 13 246 4.0E-24
sp|B1X6P4|YBGL_ECODH UPF0271 protein YbgL OS=Escherichia coli (strain K12 / DH10B) GN=ybgL PE=3 SV=1 13 246 4.0E-24
sp|C4ZWI8|YBGL_ECOBW UPF0271 protein YbgL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ybgL PE=3 SV=1 13 246 4.0E-24
sp|B7LKQ8|YBGL_ESCF3 UPF0271 protein YbgL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ybgL PE=3 SV=1 13 242 7.0E-24
sp|Q83S86|YBGL_SHIFL UPF0271 protein YbgL OS=Shigella flexneri GN=ybgL PE=3 SV=1 13 242 1.0E-23
sp|Q3Z490|YBGL_SHISS UPF0271 protein YbgL OS=Shigella sonnei (strain Ss046) GN=ybgL PE=3 SV=1 13 246 1.0E-23
sp|C0PWD6|YBGL_SALPC UPF0271 protein YbgL OS=Salmonella paratyphi C (strain RKS4594) GN=ybgL PE=3 SV=1 13 265 1.0E-23
sp|B5BC95|YBGL_SALPK UPF0271 protein YbgL OS=Salmonella paratyphi A (strain AKU_12601) GN=ybgL PE=3 SV=1 13 265 3.0E-23
sp|Q5PCK6|YBGL_SALPA UPF0271 protein YbgL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ybgL PE=3 SV=1 13 265 3.0E-23
sp|B2TU96|YBGL_SHIB3 UPF0271 protein YbgL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ybgL PE=3 SV=1 13 242 4.0E-23
sp|Q324J7|YBGL_SHIBS UPF0271 protein YbgL OS=Shigella boydii serotype 4 (strain Sb227) GN=ybgL PE=3 SV=1 13 242 4.0E-23
sp|A7ZXX4|YBGL_ECOHS UPF0271 protein YbgL OS=Escherichia coli O9:H4 (strain HS) GN=ybgL PE=3 SV=1 13 242 4.0E-23
sp|B7M5M7|YBGL_ECO8A UPF0271 protein YbgL OS=Escherichia coli O8 (strain IAI1) GN=ybgL PE=3 SV=1 13 242 4.0E-23
sp|B7LAB9|YBGL_ECO55 UPF0271 protein YbgL OS=Escherichia coli (strain 55989 / EAEC) GN=ybgL PE=3 SV=1 13 242 4.0E-23
sp|A7ZJ94|YBGL_ECO24 UPF0271 protein YbgL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ybgL PE=3 SV=1 13 242 4.0E-23
sp|B6I7Y4|YBGL_ECOSE UPF0271 protein YbgL OS=Escherichia coli (strain SE11) GN=ybgL PE=3 SV=1 13 242 5.0E-23
sp|B1IY16|YBGL_ECOLC UPF0271 protein YbgL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ybgL PE=3 SV=1 13 242 5.0E-23
sp|Q0T6V3|YBGL_SHIF8 UPF0271 protein YbgL OS=Shigella flexneri serotype 5b (strain 8401) GN=ybgL PE=3 SV=1 13 242 6.0E-23
sp|B5YQQ2|YBGL_ECO5E UPF0271 protein YbgL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ybgL PE=3 SV=1 13 242 6.0E-23
sp|Q8X9C8|YBGL_ECO57 UPF0271 protein YbgL OS=Escherichia coli O157:H7 GN=ybgL PE=3 SV=1 13 242 6.0E-23
sp|Q32IM0|YBGL_SHIDS UPF0271 protein YbgL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ybgL PE=3 SV=1 13 242 6.0E-23
sp|Q8FJU6|YBGL_ECOL6 UPF0271 protein YbgL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ybgL PE=3 SV=1 13 242 8.0E-23
sp|Q1REL0|YBGL_ECOUT UPF0271 protein YbgL OS=Escherichia coli (strain UTI89 / UPEC) GN=ybgL PE=3 SV=1 13 242 9.0E-23
sp|Q0TJX9|YBGL_ECOL5 UPF0271 protein YbgL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ybgL PE=3 SV=1 13 242 9.0E-23
sp|A1A8W9|YBGL_ECOK1 UPF0271 protein YbgL OS=Escherichia coli O1:K1 / APEC GN=ybgL PE=3 SV=1 13 242 9.0E-23
sp|B7MPK9|YBGL_ECO81 UPF0271 protein YbgL OS=Escherichia coli O81 (strain ED1a) GN=ybgL PE=3 SV=1 13 242 9.0E-23
sp|B7MFX2|YBGL_ECO45 UPF0271 protein YbgL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ybgL PE=3 SV=1 13 242 9.0E-23
sp|B7UKY6|YBGL_ECO27 UPF0271 protein YbgL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ybgL PE=3 SV=1 13 242 9.0E-23
sp|B7NMQ9|YBGL_ECO7I UPF0271 protein YbgL OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ybgL PE=3 SV=1 13 242 9.0E-22
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.538 0.3984 0.0071 0.0553 0.4124 0.0302 0.0707 0.1759 0.1274 0.2761

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6507
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5592
Ophiocordyceps australis map64 (Brazil) OphauB2|1034
Ophiocordyceps subramaniannii Hirsu2|1099 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1099
MAPTSMPWASKPVEIHCDMGEAFGNWKMGDDEAIMPYITACSIACGFHAGDPLVMYETVKSAQRHKVRIGAHPSF
LDLQGFGRREIKMDALECEKMVIYQIGALKAFLDIEGIPLSHVSPHGALYGVMCKDKTICEAVCRAARHFTSSGG
APVPMIGAANTLMETTCAAMGIPFIQEIIADLEYDENGDCIISRTHEALNLQALRARLAHALRSGTIESRDEKQM
VDLKLSTAPLSLCVHSDTPDATRIVGITREVVDGFNKERLP*
Coding >Hirsu2|1099
ATGGCGCCAACGTCTATGCCGTGGGCCTCCAAGCCCGTCGAGATTCATTGCGACATGGGCGAAGCCTTCGGAAAC
TGGAAGATGGGTGACGACGAGGCCATCATGCCTTACATCACCGCCTGCTCCATCGCCTGCGGCTTCCACGCCGGC
GACCCGTTGGTCATGTACGAAACGGTCAAGTCGGCCCAGCGCCACAAGGTCCGCATCGGCGCCCACCCGTCCTTT
CTCGACCTGCAGGGCTTCGGCCGCCGAGAGATCAAGATGGACGCGCTCGAGTGCGAGAAGATGGTCATCTACCAG
ATTGGCGCCCTGAAGGCCTTCCTCGATATAGAGGGCATCCCCTTGTCCCATGTCAGCCCGCACGGCGCTCTCTAC
GGCGTCATGTGCAAGGACAAGACCATCTGCGAGGCCGTGTGTCGCGCCGCCCGGCATTTCACCTCATCCGGGGGC
GCGCCCGTGCCCATGATCGGCGCGGCCAACACGCTGATGGAGACGACGTGCGCCGCCATGGGCATCCCCTTCATC
CAGGAGATCATCGCCGACCTCGAGTACGACGAGAATGGCGACTGTATCATTTCGCGCACGCACGAGGCGCTCAAT
CTGCAGGCCCTTCGCGCCCGTCTGGCTCACGCCCTCCGCAGCGGCACCATCGAGAGCAGAGACGAGAAGCAGATG
GTCGACCTCAAGCTGAGCACGGCACCGTTGAGCTTGTGCGTTCACAGTGACACCCCAGACGCCACACGGATTGTC
GGCATCACCCGGGAGGTCGTCGACGGCTTCAACAAAGAGCGTCTTCCGTAG
Transcript >Hirsu2|1099
ATGGCGCCAACGTCTATGCCGTGGGCCTCCAAGCCCGTCGAGATTCATTGCGACATGGGCGAAGCCTTCGGAAAC
TGGAAGATGGGTGACGACGAGGCCATCATGCCTTACATCACCGCCTGCTCCATCGCCTGCGGCTTCCACGCCGGC
GACCCGTTGGTCATGTACGAAACGGTCAAGTCGGCCCAGCGCCACAAGGTCCGCATCGGCGCCCACCCGTCCTTT
CTCGACCTGCAGGGCTTCGGCCGCCGAGAGATCAAGATGGACGCGCTCGAGTGCGAGAAGATGGTCATCTACCAG
ATTGGCGCCCTGAAGGCCTTCCTCGATATAGAGGGCATCCCCTTGTCCCATGTCAGCCCGCACGGCGCTCTCTAC
GGCGTCATGTGCAAGGACAAGACCATCTGCGAGGCCGTGTGTCGCGCCGCCCGGCATTTCACCTCATCCGGGGGC
GCGCCCGTGCCCATGATCGGCGCGGCCAACACGCTGATGGAGACGACGTGCGCCGCCATGGGCATCCCCTTCATC
CAGGAGATCATCGCCGACCTCGAGTACGACGAGAATGGCGACTGTATCATTTCGCGCACGCACGAGGCGCTCAAT
CTGCAGGCCCTTCGCGCCCGTCTGGCTCACGCCCTCCGCAGCGGCACCATCGAGAGCAGAGACGAGAAGCAGATG
GTCGACCTCAAGCTGAGCACGGCACCGTTGAGCTTGTGCGTTCACAGTGACACCCCAGACGCCACACGGATTGTC
GGCATCACCCGGGAGGTCGTCGACGGCTTCAACAAAGAGCGTCTTCCGTAG
Gene >Hirsu2|1099
ATGGCGCCAACGTCTATGCCGTGGGCCTCCAAGCCCGTCGAGATTCATTGCGACATGGGCGAAGCCTTCGGAAAC
TGGAAGATGGTATGCCAGTCTCCCCGGCAGGATGCTCTCGGCATCGCTACCCGCCCCCAAAAGGGCTAACGACGC
CGTGGCCCGCCACGAAAGGGTGACGACGAGGCCATCATGCCTTACATCACCGCCTGCTCCATCGCCTGCGGCTTC
CACGCCGGCGACCCGTTGGTCATGTACGAAACGGTCAAGTCGGCCCAGCGCCACAAGGTCCGCATCGGCGCCCAC
CCGTCCTTTCTCGACCTGCAGGGCTTCGGCCGCCGAGAGATCAAGATGGACGCGCTCGAGTGCGAGAAGATGGTC
ATCTACCAGATTGGCGCCCTGAAGGCCTTCCTCGATATAGAGGGCATCCCCTTGTCCCATGTCAGCGTACGATCA
CCTCCATGTTCCTGCTCTTCTCATCCCCCCTACCGCTTACCAGTCGCCGTGGTCGCGACAGAGTTGTGCTTGCGG
CGGTCTGGCCCTGTTATGCTGACCGGAGGAGCCGTGACCGCAGCCGCACGGCGCTCTCTACGGCGTCATGTGCAA
GGACAAGACCATCTGCGAGGCCGTGTGTCGCGCCGCCCGGCATTTCACCTCATCCGGGGGCGCGCCCGTGCCCAT
GATCGGCGCGGCCAACACGCTGATGGAGACGACGTGCGCCGCCATGGGCATCCCCTTCATCCAGGAGATCATCGC
CGACCTCGAGTACGACGAGAATGGCGACTGTATCATTTCGCGCACGCACGAGGCGCTCAATCTGCAGGCCCTTCG
CGCCCGTCTGGCTCACGCCCTCCGCAGCGGCACCATCGAGAGCAGAGACGAGAAGCAGATGGTCGACCTCAAGCT
GAGCACGGCACCGTTGAGCTTGTGCGTTCACAGTGACACCCCAGACGCCACACGGATTGTCGGCATCACCCGGGA
GGTCGTCGACGGCTTCAACAAAGAGCGTCTTCCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail