Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10983
Gene name
LocationContig_94:22231..24340
Strand+
Gene length (bp)2109
Transcript length (bp)1740
Coding sequence length (bp)1740
Protein length (aa) 580

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 7.9E-151 76 537
PF13520 AA_permease_2 Amino acid permease 6.0E-38 77 497

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34054|INDA1_HYPAT Amino-acid permease inda1 OS=Hypocrea atroviridis GN=inda1 PE=2 SV=1 3 579 0.0E+00
sp|Q9P5N4|YH81_SCHPO Uncharacterized amino-acid permease C359.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC359.01 PE=3 SV=2 1 578 1.0E-160
sp|Q9URZ4|CAT1_SCHPO Cationic amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cat1 PE=1 SV=3 22 578 4.0E-157
sp|P19145|GAP1_YEAST General amino-acid permease GAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAP1 PE=1 SV=2 52 576 2.0E-153
sp|Q9P5N2|AAT1_SCHPO Amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aat1 PE=3 SV=1 1 578 2.0E-152
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34054|INDA1_HYPAT Amino-acid permease inda1 OS=Hypocrea atroviridis GN=inda1 PE=2 SV=1 3 579 0.0E+00
sp|Q9P5N4|YH81_SCHPO Uncharacterized amino-acid permease C359.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC359.01 PE=3 SV=2 1 578 1.0E-160
sp|Q9URZ4|CAT1_SCHPO Cationic amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cat1 PE=1 SV=3 22 578 4.0E-157
sp|P19145|GAP1_YEAST General amino-acid permease GAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAP1 PE=1 SV=2 52 576 2.0E-153
sp|Q9P5N2|AAT1_SCHPO Amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aat1 PE=3 SV=1 1 578 2.0E-152
sp|Q9P768|YI26_SCHPO Uncharacterized amino-acid permease P7G5.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP7G5.06 PE=3 SV=1 66 551 7.0E-152
sp|O60170|MEU22_SCHPO Probable amino-acid permease meu22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu22 PE=2 SV=1 67 549 8.0E-150
sp|B5BP45|YP51_SCHPO Uncharacterized amino-acid permease C460.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.01c PE=3 SV=1 68 579 5.0E-147
sp|P06775|HIP1_YEAST Histidine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIP1 PE=1 SV=2 1 554 1.0E-134
sp|Q9HDV2|YHE1_SCHPO Uncharacterized amino-acid permease PB2B2.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.01 PE=3 SV=1 16 548 7.0E-133
sp|P40901|ISP5_SCHPO Sexual differentiation process putative amino-acid permease isp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp5 PE=2 SV=2 67 557 1.0E-128
sp|P38967|TAT2_YEAST Tryptophan permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAT2 PE=1 SV=1 53 568 4.0E-126
sp|Q876K6|AGP1_SACU7 General amino acid permease AGP1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AGP1 PE=3 SV=1 37 574 1.0E-125
sp|P25376|AGP1_YEAST General amino acid permease AGP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP1 PE=1 SV=3 37 574 1.0E-125
sp|A6ZTG5|AGP1_YEAS7 General amino acid permease AGP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=AGP1 PE=3 SV=1 37 574 3.0E-125
sp|P38084|BAP2_YEAST Leu/Val/Ile amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAP2 PE=1 SV=2 67 565 8.0E-123
sp|P48813|GNP1_YEAST High-affinity glutamine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GNP1 PE=1 SV=2 25 576 3.0E-122
sp|P41815|BAP3_YEAST Valine amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAP3 PE=1 SV=2 14 565 3.0E-117
sp|Q12372|MMP1_YEAST S-methylmethionine permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMP1 PE=1 SV=1 69 579 1.0E-112
sp|Q08986|SAM3_YEAST S-adenosylmethionine permease SAM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAM3 PE=1 SV=1 69 579 1.0E-110
sp|P38085|TAT1_YEAST Valine/tyrosine/tryptophan amino-acid permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAT1 PE=1 SV=1 15 551 2.0E-109
sp|Q92367|AAP1_SCHPO Amino-acid permease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aap1 PE=3 SV=1 23 567 1.0E-106
sp|P04817|CAN1_YEAST Arginine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAN1 PE=1 SV=2 67 578 9.0E-102
sp|P32487|LYP1_YEAST Lysine-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYP1 PE=1 SV=2 29 568 1.0E-100
sp|P25737|LYSP_ECOLI Lysine-specific permease OS=Escherichia coli (strain K12) GN=lysP PE=1 SV=5 68 552 4.0E-97
sp|P53388|DIP5_YEAST Dicarboxylic amino acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP5 PE=1 SV=1 3 557 2.0E-90
sp|P38971|ALP1_YEAST Basic amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALP1 PE=1 SV=2 24 578 2.0E-89
sp|P43059|CAN1_CANAW Lysine/arginine permease OS=Candida albicans (strain WO-1) GN=CAN1 PE=3 SV=2 67 554 2.0E-89
sp|P18696|PUTX_EMENI Proline-specific permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prnB PE=2 SV=2 69 554 3.0E-89
sp|Q9URZ3|PUT4_SCHPO Probable proline-specific permease put4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=put4 PE=3 SV=1 42 554 2.0E-87
sp|O74543|YCV4_SCHPO Uncharacterized amino-acid permease C777.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC777.04 PE=3 SV=1 28 472 5.0E-87
sp|P15380|PUT4_YEAST Proline-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUT4 PE=2 SV=2 67 565 8.0E-82
sp|O59831|YCUB_SCHPO Uncharacterized amino-acid permease C965.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.11c PE=3 SV=1 68 578 7.0E-81
sp|P43548|AGP3_YEAST General amino acid permease AGP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP3 PE=1 SV=1 68 552 8.0E-79
sp|P39137|ROCE_BACSU Amino-acid permease RocE OS=Bacillus subtilis (strain 168) GN=rocE PE=2 SV=1 67 492 4.0E-76
sp|P39636|ROCC_BACSU Amino-acid permease RocC OS=Bacillus subtilis (strain 168) GN=rocC PE=2 SV=1 67 473 6.0E-75
sp|Q9C0V0|YQD2_SCHPO Probable amino-acid permease PB1C11.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.02 PE=3 SV=1 67 554 2.0E-74
sp|P42087|HUTM_BACSU Putative histidine permease OS=Bacillus subtilis (strain 168) GN=hutM PE=3 SV=2 67 486 2.0E-72
sp|O31462|YBGF_BACSU Uncharacterized amino acid permease YbgF OS=Bacillus subtilis (strain 168) GN=ybgF PE=3 SV=1 69 473 1.0E-68
sp|P38090|AGP2_YEAST General amino acid permease AGP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP2 PE=1 SV=1 66 564 4.0E-68
sp|Q47689|MMUP_ECOLI Probable S-methylmethionine permease OS=Escherichia coli (strain K12) GN=mmuP PE=3 SV=2 68 491 8.0E-67
sp|Q8X968|AROP_ECO57 Aromatic amino acid transport protein AroP OS=Escherichia coli O157:H7 GN=aroP PE=3 SV=1 67 496 1.0E-61
sp|P24207|PHEP_ECOLI Phenylalanine-specific permease OS=Escherichia coli (strain K12) GN=pheP PE=1 SV=1 68 491 3.0E-61
sp|P59737|AROP_SHIFL Aromatic amino acid transport protein AroP OS=Shigella flexneri GN=aroP PE=3 SV=1 67 496 7.0E-61
sp|Q8FL49|AROP_ECOL6 Aromatic amino acid transport protein AroP OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aroP PE=3 SV=1 67 496 8.0E-61
sp|O34618|YTNA_BACSU Uncharacterized amino acid permease YtnA OS=Bacillus subtilis (strain 168) GN=ytnA PE=3 SV=1 67 494 9.0E-61
sp|P15993|AROP_ECOLI Aromatic amino acid transport protein AroP OS=Escherichia coli (strain K12) GN=aroP PE=1 SV=3 67 496 1.0E-60
sp|P0CK99|AROP_SALTY Aromatic amino acid transport protein AroP OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aroP PE=3 SV=1 67 462 3.0E-56
sp|E1W822|AROP_SALTS Aromatic amino acid transport protein AroP OS=Salmonella typhimurium (strain SL1344) GN=aroP PE=3 SV=1 67 462 3.0E-56
sp|P0A188|AROP_SALTI Aromatic amino acid transport protein AroP OS=Salmonella typhi GN=aroP PE=3 SV=1 67 462 3.0E-56
sp|P46349|GABP_BACSU GABA permease OS=Bacillus subtilis (strain 168) GN=gabP PE=1 SV=3 68 492 2.0E-55
sp|P37460|PROY_SALTY Proline-specific permease ProY OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proY PE=3 SV=3 67 489 9.0E-54
sp|P0AAE2|PROY_ECOLI Proline-specific permease ProY OS=Escherichia coli (strain K12) GN=proY PE=1 SV=1 67 489 3.0E-51
sp|P0AAE3|PROY_ECOL6 Proline-specific permease ProY OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=proY PE=3 SV=1 67 489 3.0E-51
sp|P0AAE4|PROY_ECO57 Proline-specific permease ProY OS=Escherichia coli O157:H7 GN=proY PE=3 SV=1 67 489 3.0E-51
sp|P0AAE0|CYCA_ECOLI D-serine/D-alanine/glycine transporter OS=Escherichia coli (strain K12) GN=cycA PE=1 SV=1 62 491 4.0E-51
sp|P0AAE1|CYCA_ECO57 D-serine/D-alanine/glycine transporter OS=Escherichia coli O157:H7 GN=cycA PE=3 SV=1 62 491 4.0E-51
sp|P27837|YIFK_ECOLI Probable transport protein YifK OS=Escherichia coli (strain K12) GN=yifK PE=1 SV=4 67 472 1.0E-50
sp|P25527|GABP_ECOLI GABA permease OS=Escherichia coli (strain K12) GN=gabP PE=1 SV=1 67 497 1.0E-50
sp|P0A189|YIFK_SALTY Probable transport protein YifK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yifK PE=3 SV=1 67 496 8.0E-50
sp|P0A190|YIFK_SALTI Probable transport protein YifK OS=Salmonella typhi GN=yifK PE=3 SV=1 67 496 8.0E-50
sp|Q03770|SSY1_YEAST SPS-sensor component SSY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSY1 PE=1 SV=1 67 571 2.0E-48
sp|P77610|ANSP_ECOLI L-asparagine permease OS=Escherichia coli (strain K12) GN=ansP PE=3 SV=2 69 480 4.0E-48
sp|P40812|ANSP_SALTY L-asparagine permease OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ansP PE=3 SV=1 69 480 2.0E-47
sp|P96704|YDGF_BACSU Uncharacterized transporter YdgF OS=Bacillus subtilis (strain 168) GN=ydgF PE=3 SV=1 46 491 6.0E-47
sp|P54425|YBXG_BACSU Uncharacterized transporter YbxG OS=Bacillus subtilis (strain 168) GN=ybxG PE=3 SV=2 67 496 2.0E-45
sp|Q9I703|BAUD_PSEAE Probable GABA permease OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bauD PE=2 SV=1 52 466 2.0E-45
sp|O06005|AAPA_BACSU Amino-acid permease AapA OS=Bacillus subtilis (strain 168) GN=aapA PE=3 SV=2 67 491 4.0E-45
sp|Q46065|AROP_CORGL Aromatic amino acid transport protein AroP OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aroP PE=3 SV=1 72 468 3.0E-44
sp|P9WQM7|ANSP2_MYCTU L-asparagine permease 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ansP2 PE=1 SV=1 69 495 3.0E-43
sp|P9WQM6|ANSP2_MYCTO L-asparagine permease 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ansP2 PE=3 SV=1 69 495 3.0E-43
sp|P0A4W1|ANSP2_MYCBO L-asparagine permease 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ansP2 PE=3 SV=1 69 495 3.0E-43
sp|P9WQM9|ANSP1_MYCTU L-asparagine permease 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ansP1 PE=1 SV=1 69 456 2.0E-41
sp|P9WQM8|ANSP1_MYCTO L-asparagine permease 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ansP1 PE=3 SV=1 69 456 2.0E-41
sp|Q9X7P0|ANSP_STRCO L-asparagine permease OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ansP PE=3 SV=1 69 457 2.0E-41
sp|Q7VEQ4|ANSP1_MYCBO L-asparagine permease 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ansP1 PE=3 SV=1 69 456 7.0E-41
sp|O32257|YVBW_BACSU Uncharacterized amino acid permease YvbW OS=Bacillus subtilis (strain 168) GN=yvbW PE=2 SV=1 67 456 8.0E-41
sp|P94383|YCGH_BACSU Uncharacterized transporter YcgH OS=Bacillus subtilis (strain 168) GN=ycgH PE=3 SV=3 76 444 6.0E-23
sp|P45495|YPEV_LACDL Uncharacterized transporter in pepV 3'region (Fragment) OS=Lactobacillus delbrueckii subsp. lactis PE=3 SV=1 70 230 2.0E-12
sp|Q797A7|YFNA_BACSU Uncharacterized amino acid permease YfnA OS=Bacillus subtilis (strain 168) GN=yfnA PE=3 SV=1 67 456 3.0E-12
sp|Q9ASS7|CAAT2_ARATH Cationic amino acid transporter 2, vacuolar OS=Arabidopsis thaliana GN=CAT2 PE=2 SV=1 67 417 2.0E-08
sp|Q45577|YBEC_BACSU Probable amino acid-proton symporter YbeC OS=Bacillus subtilis (strain 168) GN=ybeC PE=3 SV=3 67 394 2.0E-08
sp|O07576|YHDG_BACSU Uncharacterized amino acid permease YhdG OS=Bacillus subtilis (strain 168) GN=yhdG PE=2 SV=1 67 391 7.0E-08
sp|Q8TBB6|S7A14_HUMAN Probable cationic amino acid transporter OS=Homo sapiens GN=SLC7A14 PE=2 SV=3 67 300 1.0E-07
sp|Q6DCE8|CTR2_XENLA Cationic amino acid transporter 2 OS=Xenopus laevis GN=slc7a2 PE=2 SV=1 62 297 2.0E-07
sp|Q9N1Q4|LAT2_RABIT Large neutral amino acids transporter small subunit 2 OS=Oryctolagus cuniculus GN=SLC7A8 PE=1 SV=1 50 422 6.0E-07
sp|Q9QXW9|LAT2_MOUSE Large neutral amino acids transporter small subunit 2 OS=Mus musculus GN=Slc7a8 PE=1 SV=1 41 422 1.0E-06
sp|Q8BLQ7|CTR4_MOUSE Cationic amino acid transporter 4 OS=Mus musculus GN=Slc7a4 PE=1 SV=1 46 300 1.0E-06
sp|Q09143|CTR1_MOUSE High affinity cationic amino acid transporter 1 OS=Mus musculus GN=Slc7a1 PE=1 SV=1 67 300 2.0E-06
sp|Q9C5D6|CAAT9_ARATH Cationic amino acid transporter 9, chloroplastic OS=Arabidopsis thaliana GN=CAT9 PE=2 SV=1 67 400 2.0E-06
sp|Q5RAE3|LAT2_PONAB Large neutral amino acids transporter small subunit 2 OS=Pongo abelii GN=SLC7A8 PE=2 SV=2 54 422 3.0E-06
sp|Q9UHI5|LAT2_HUMAN Large neutral amino acids transporter small subunit 2 OS=Homo sapiens GN=SLC7A8 PE=1 SV=1 54 422 3.0E-06
sp|O08812|CTR3_RAT Cationic amino acid transporter 3 OS=Rattus norvegicus GN=Slc7a3 PE=2 SV=1 46 163 3.0E-06
sp|P70423|CTR3_MOUSE Cationic amino acid transporter 3 OS=Mus musculus GN=Slc7a3 PE=2 SV=1 46 163 4.0E-06
sp|Q9WVR6|LAT2_RAT Large neutral amino acids transporter small subunit 2 OS=Rattus norvegicus GN=Slc7a8 PE=1 SV=1 41 422 5.0E-06
sp|P30823|CTR1_RAT High affinity cationic amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a1 PE=2 SV=1 67 300 5.0E-06
sp|O43246|CTR4_HUMAN Cationic amino acid transporter 4 OS=Homo sapiens GN=SLC7A4 PE=2 SV=3 67 313 7.0E-06
sp|Q8WY07|CTR3_HUMAN Cationic amino acid transporter 3 OS=Homo sapiens GN=SLC7A3 PE=1 SV=1 48 163 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 77 99 22
2 106 128 22
3 157 179 22
4 186 208 22
5 212 234 22
6 303 322 19
7 356 378 22
8 404 421 17
9 431 453 22
10 474 496 22
11 516 533 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10983
MSSKDEPLDAGPLAGEKEVGVPTYEGSSQVISKETASPTYRDPNFMTRNGLNLESFKRAHYGPGVVELERPMKTR
HLHMIAIGGSIGAGFFVGSGSALSKGGPGSVLIDFLIIGIMMFNVVYALGELSVLYPVSGSFYTYSARFIDPSWG
FAMGWNYVFQWAIVLPLELTVCGLTIQYWNAEISVGVWIAVFLAAIIIVNIFGALGYAEEEFWSSCFKLAATVIF
MIIALVLVCGGGPKSGRYNEYWGARYWYDPGAFKNGFKGFCSVFVTAAFAFSGTELVGLAAAESKNPVKSLPGAI
KQIFWRITLFYILGLFFVGLLVDANDKGLLSEANFDVKASPFVLVGKYANLRGFDHFMNLVILVSVLSIGVSGVY
GGSRTLTALAQQGYAPQIFTYIDKSGRPLPSVMFVIAFGLLAFVNLDAKGPVVFDWLQALSGLAALFTWGSICLA
HIRFRKAWKYHGHTLDEIPFKAPAGVAGSWLGLFLCFIVLVAQFYTAIVAKPGESGMGTAEDFFKAYLAAPVVLL
FWLAGYLWKRTGWLRTEEMDVDTGRRELDWDEIRAYREEKATWPAWKRVYNMVF*
Coding >Hirsu2|10983
ATGTCGTCCAAAGACGAGCCTCTCGATGCCGGCCCCCTGGCTGGCGAGAAGGAGGTCGGCGTCCCCACTTACGAG
GGATCCAGCCAGGTCATCTCCAAGGAAACGGCCTCTCCCACCTATCGCGATCCGAACTTCATGACCCGCAATGGC
CTCAACCTCGAGTCCTTCAAGCGCGCACATTACGGCCCCGGCGTCGTCGAACTCGAGCGCCCTATGAAGACGCGC
CACCTACACATGATCGCCATCGGTGGTAGCATCGGGGCTGGCTTCTTCGTCGGATCCGGCTCGGCCTTGTCAAAA
GGTGGCCCCGGCAGTGTCCTGATTGACTTCCTCATCATCGGCATCATGATGTTCAACGTTGTTTATGCGCTCGGC
GAACTTTCCGTTCTCTACCCCGTCTCTGGCAGCTTCTATACCTACTCGGCTCGCTTCATCGACCCCTCGTGGGGT
TTCGCCATGGGCTGGAATTACGTCTTCCAGTGGGCCATAGTCCTGCCTCTAGAGCTTACGGTTTGCGGCTTGACT
ATCCAGTACTGGAACGCCGAGATCTCGGTAGGCGTATGGATCGCCGTTTTCTTAGCCGCCATCATCATTGTGAAT
ATCTTCGGCGCCCTAGGGTATGCCGAGGAGGAGTTCTGGTCATCGTGCTTCAAGCTGGCCGCCACAGTCATCTTC
ATGATTATCGCCCTCGTCCTGGTCTGCGGCGGTGGCCCCAAGTCCGGACGCTACAACGAGTACTGGGGGGCCCGC
TACTGGTACGACCCCGGTGCCTTCAAGAACGGTTTTAAGGGCTTCTGCTCCGTCTTCGTTACGGCGGCCTTCGCT
TTTTCTGGTACCGAGCTAGTTGGCCTCGCGGCTGCCGAGTCCAAGAACCCCGTCAAATCGCTCCCGGGCGCTATC
AAGCAGATCTTCTGGCGTATCACCCTCTTCTATATCCTCGGCCTCTTTTTCGTCGGCCTACTCGTCGACGCGAAT
GATAAGGGTTTACTCTCCGAGGCCAACTTCGATGTTAAGGCGTCGCCCTTTGTCCTTGTCGGCAAGTACGCTAAC
CTGCGGGGCTTCGACCATTTCATGAATCTTGTGATTCTTGTATCCGTCCTATCTATCGGCGTCTCCGGCGTCTAT
GGCGGCTCACGAACTCTTACGGCCCTGGCTCAACAGGGCTACGCGCCCCAAATTTTTACATATATCGATAAGTCC
GGCCGGCCCTTGCCATCCGTCATGTTCGTTATAGCCTTCGGTCTTTTGGCCTTTGTCAACTTGGATGCCAAAGGC
CCTGTCGTCTTCGACTGGCTGCAGGCGCTGTCGGGTCTGGCTGCTCTGTTCACTTGGGGCTCTATCTGCTTGGCC
CACATCCGATTTCGCAAGGCTTGGAAATATCACGGCCATACACTCGACGAAATTCCCTTCAAAGCCCCCGCCGGC
GTTGCCGGCTCATGGCTTGGCTTGTTTCTCTGTTTCATCGTCTTAGTAGCCCAGTTTTACACTGCCATCGTGGCC
AAACCCGGAGAATCCGGGATGGGCACGGCCGAAGATTTCTTCAAGGCCTATCTCGCGGCGCCGGTCGTCCTGCTG
TTCTGGCTTGCCGGGTACTTATGGAAGCGCACTGGCTGGCTTCGGACCGAGGAAATGGACGTCGACACGGGGCGA
CGTGAACTCGACTGGGACGAGATTCGCGCCTATCGGGAAGAGAAGGCCACGTGGCCAGCGTGGAAGCGCGTTTAC
AACATGGTGTTTTGA
Transcript >Hirsu2|10983
ATGTCGTCCAAAGACGAGCCTCTCGATGCCGGCCCCCTGGCTGGCGAGAAGGAGGTCGGCGTCCCCACTTACGAG
GGATCCAGCCAGGTCATCTCCAAGGAAACGGCCTCTCCCACCTATCGCGATCCGAACTTCATGACCCGCAATGGC
CTCAACCTCGAGTCCTTCAAGCGCGCACATTACGGCCCCGGCGTCGTCGAACTCGAGCGCCCTATGAAGACGCGC
CACCTACACATGATCGCCATCGGTGGTAGCATCGGGGCTGGCTTCTTCGTCGGATCCGGCTCGGCCTTGTCAAAA
GGTGGCCCCGGCAGTGTCCTGATTGACTTCCTCATCATCGGCATCATGATGTTCAACGTTGTTTATGCGCTCGGC
GAACTTTCCGTTCTCTACCCCGTCTCTGGCAGCTTCTATACCTACTCGGCTCGCTTCATCGACCCCTCGTGGGGT
TTCGCCATGGGCTGGAATTACGTCTTCCAGTGGGCCATAGTCCTGCCTCTAGAGCTTACGGTTTGCGGCTTGACT
ATCCAGTACTGGAACGCCGAGATCTCGGTAGGCGTATGGATCGCCGTTTTCTTAGCCGCCATCATCATTGTGAAT
ATCTTCGGCGCCCTAGGGTATGCCGAGGAGGAGTTCTGGTCATCGTGCTTCAAGCTGGCCGCCACAGTCATCTTC
ATGATTATCGCCCTCGTCCTGGTCTGCGGCGGTGGCCCCAAGTCCGGACGCTACAACGAGTACTGGGGGGCCCGC
TACTGGTACGACCCCGGTGCCTTCAAGAACGGTTTTAAGGGCTTCTGCTCCGTCTTCGTTACGGCGGCCTTCGCT
TTTTCTGGTACCGAGCTAGTTGGCCTCGCGGCTGCCGAGTCCAAGAACCCCGTCAAATCGCTCCCGGGCGCTATC
AAGCAGATCTTCTGGCGTATCACCCTCTTCTATATCCTCGGCCTCTTTTTCGTCGGCCTACTCGTCGACGCGAAT
GATAAGGGTTTACTCTCCGAGGCCAACTTCGATGTTAAGGCGTCGCCCTTTGTCCTTGTCGGCAAGTACGCTAAC
CTGCGGGGCTTCGACCATTTCATGAATCTTGTGATTCTTGTATCCGTCCTATCTATCGGCGTCTCCGGCGTCTAT
GGCGGCTCACGAACTCTTACGGCCCTGGCTCAACAGGGCTACGCGCCCCAAATTTTTACATATATCGATAAGTCC
GGCCGGCCCTTGCCATCCGTCATGTTCGTTATAGCCTTCGGTCTTTTGGCCTTTGTCAACTTGGATGCCAAAGGC
CCTGTCGTCTTCGACTGGCTGCAGGCGCTGTCGGGTCTGGCTGCTCTGTTCACTTGGGGCTCTATCTGCTTGGCC
CACATCCGATTTCGCAAGGCTTGGAAATATCACGGCCATACACTCGACGAAATTCCCTTCAAAGCCCCCGCCGGC
GTTGCCGGCTCATGGCTTGGCTTGTTTCTCTGTTTCATCGTCTTAGTAGCCCAGTTTTACACTGCCATCGTGGCC
AAACCCGGAGAATCCGGGATGGGCACGGCCGAAGATTTCTTCAAGGCCTATCTCGCGGCGCCGGTCGTCCTGCTG
TTCTGGCTTGCCGGGTACTTATGGAAGCGCACTGGCTGGCTTCGGACCGAGGAAATGGACGTCGACACGGGGCGA
CGTGAACTCGACTGGGACGAGATTCGCGCCTATCGGGAAGAGAAGGCCACGTGGCCAGCGTGGAAGCGCGTTTAC
AACATGGTGTTTTGA
Gene >Hirsu2|10983
ATGTCGTCCAAAGACGAGCCTCTCGATGCCGGCCCCCTGGCTGGCGAGAAGGAGGTCGGCGTCCCCACTTACGAG
GGATCCAGCCAGGTCATCTCCAAGGAAACGGCCTCTCCCACCTATCGCGATCCGAACTTCATGACCCGCAATGGC
CTCAACCTCGAGTCCTTCAAGCGCGCACATTACGGCCCCGGCGTCGTCGAACTCGAGCGCCCTATGAAGACGCGC
CACCTACACATGAGTATGCAATCCCCAGCACCCTGAACTGGTGACGAGGCTAACAAGATGGCCAAAGTCGCCATC
GGTGGTAGCATCGGGGCTGGCTTCTTCGTCGGATCCGGCTCGGCCTTGTCAAAAGGTGTACGTCACATCTCTTCT
GTGCTTTGCCTTACTCGATACTTACCTCTCTCGGTTGGACAGGGCCCCGGCAGTGTCCTGATTGACTTCCTCATC
ATCGGCATCATGATGTTCAACGTTGGTGAGTGCACCCCTGTGCCATGGCCTTGGCCTACGTGCAATGACCGGGAC
CGGTGCCGTCAAGCCCAGGCCCCCAAAATCTTGCGCTGTCACCGCTCTGTCGCGCCCGGCCGGCCGAGACAAGCC
ACTGACATCGCATGTAGTTTATGCGCTCGGCGAACTTTCCGTTCTCTACCCCGTCTCTGGCAGCTTCTATACCTA
CTCGGCTCGCTTCATCGACCCCTCGTGGGGTTTCGCCATGGGCTGGAATTACGTCTTCCAGTGGGCCATAGTCCT
GCCTCTAGAGCTTACGGTTTGCGGCTTGACTATCCAGTACTGGAACGCCGAGATCTCGGTAGGCGTATGGATCGC
CGTTTTCTTAGCCGCCATCATCATTGTGAATATCTTCGGCGCCCTAGGGTATGCCGAGGAGGAGTTCTGGTCATC
GTGCTTCAAGCTGGCCGCCACAGTCATCTTCATGATTATCGCCCTCGTCCTGGTCTGCGGCGGTGGCCCCAAGTC
CGGACGCTACAACGAGTACTGGGGGGCCCGCTACTGGTACGACCCCGGTGCCTTCAAGAACGGTTTTAAGGGCTT
CTGCTCCGTCTTCGTTACGGCGGCCTTCGCTTTTTCTGGTACCGAGCTAGTTGGCCTCGCGGCTGCCGAGTCCAA
GAACCCCGTCAAATCGCTCCCGGGCGCTATCAAGCAGATCTTCTGGCGTATCACCCTCTTCTATATCCTCGGCCT
CTTTTTCGTCGGCCTACTCGTCGACGCGAATGATAAGGGTTTACTCTCCGAGGCCAACTTCGATGTTAAGGCGTC
GCCCTTTGTCCTTGTCGGCAAGTACGCTAACCTGCGGGGCTTCGACCATTTCATGAATCTTGTGATTCTTGTATC
CGTCCTATCTATCGGCGTCTCCGGCGTCTATGGCGGCTCACGAACTCTTACGGCCCTGGCTCAACAGGGCTACGC
GCCCCAAATTTTTACATATATCGATAAGTCCGGCCGGCCCTTGCCATCCGTCATGTTCGTTATAGCCTTCGGTCT
TTTGGCCTTTGTCAACTTGGATGCCAAAGGCCCTGTCGTCTTCGACTGGCTGCAGGCGCTGTCGGGTCTGGCTGC
TCTGTTCACTTGGGGCTCTATCTGCTTGGCCCACATCCGATTTCGCAAGGCTTGGAAATATCACGGCCATACACT
CGACGAAATTCCCTTCAAAGCCCCCGCCGGCGTTGCCGGCTCATGGCTTGGCTTGTTTCTCTGTTTCATCGTCTT
AGTAGCCCAGGTAAGACTTTCATCCGCCGGCCGAATCTGCAGCCGATCCCAAAATGGCTTCAAGTCTCTCATTTC
GCCTCGTGAGAGCAAGACGATGACTGGTCGCTAACCTTGACATTGCAGTTTTACACTGCCATCGTGGCCAAACCC
GGAGAATCCGGGATGGGCACGGCCGAAGATTTCTTCAAGGCCTATCTCGCGGCGCCGGTCGTCCTGCTGTTCTGG
CTTGCCGGGTACTTATGGAAGCGCACTGGCTGGCTTCGGACCGAGGAAATGGACGTCGACACGGGGCGACGTGAA
CTCGACTGGGACGAGATTCGCGCCTATCGGGAAGAGAAGGCCACGTGGCCAGCGTGGAAGCGCGTTTACAACATG
GTGTTTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail