Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10978
Gene name
LocationContig_94:2321..4068
Strand+
Gene length (bp)1747
Transcript length (bp)1518
Coding sequence length (bp)1518
Protein length (aa) 506

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.5E-19 92 436
PF05978 UNC-93 Ion channel regulatory protein UNC-93 4.5E-10 81 196

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9URX1|YLX5_SCHPO UNC93-like protein C922.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.05c PE=3 SV=1 1 482 6.0E-147
sp|Q8LG53|UN932_ARATH UNC93-like protein 2 OS=Arabidopsis thaliana GN=At1g18010 PE=2 SV=2 49 473 2.0E-105
sp|Q56WD3|UN931_ARATH UNC93-like protein 1 OS=Arabidopsis thaliana GN=At1g18000 PE=2 SV=2 49 473 2.0E-105
sp|O14237|YEL4_SCHPO Uncharacterized membrane protein C6F6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F6.04c PE=4 SV=1 50 493 2.0E-52

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.5

Transmembrane Domains

Domain # Start End Length
1 57 79 22
2 92 109 17
3 114 136 22
4 143 165 22
5 180 199 19
6 212 234 22
7 268 285 17
8 306 328 22
9 338 355 17
10 387 409 22
11 448 470 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10978
MSSDQAKAGHEMAVDEATRQTPPDYVDFVDRPPGLLYKPFRLFGREVWYASPKVQLLMVSLVCFLCPGMYNSLTG
LGGGGQVDATAQDHANVALYSTFAVVGFFAGTFANRLGLRLTLSIGGLGYCIYSASFLSYSHTQNVGFVIFSGAF
LGLCAGLLWTAQGAIMMSYPPENSKGRYISWFWIIFNLGAVIGSLIPLAQNVNKKAGPVTDGTYIAFIILMFIGA
CLSLMLVDANKVIREDNTKVILMKNPSWLSEFKGLWETLFNEPWILLLFPMFFASNFFYTYQNNDMNAAHFNTRT
RALNNLLYWLAQIFGAILMGYCLDIHTIRRSVRGKIAFGFLVALTFIIWGGGWHWQKQQVSRQVAESKDYPGLVD
WTDGGTRFVGPMFLYFFYGFYDAIWQTSIYWFMGSLSNSGRKAANLAGFYKSIQSFGASIAYYLDGSKKDYNTIF
GLTWGLLAGSLLFALPVILFKIKDHVSMEDDLKFSDETIDDVVVGATEKADQPHV*
Coding >Hirsu2|10978
ATGTCTTCCGACCAGGCCAAGGCCGGCCACGAGATGGCCGTCGATGAGGCCACCCGCCAAACCCCTCCCGACTAC
GTCGACTTCGTCGACCGCCCCCCCGGCCTCCTGTACAAGCCATTCCGCCTCTTCGGCCGTGAGGTCTGGTATGCC
TCGCCCAAGGTCCAGCTCCTCATGGTCTCCCTCGTCTGCTTCCTCTGTCCCGGCATGTACAACTCCCTCACCGGC
CTCGGCGGCGGCGGCCAGGTCGACGCCACCGCCCAAGACCACGCCAACGTCGCCCTCTACAGCACCTTCGCCGTC
GTCGGCTTCTTCGCCGGCACCTTCGCCAACCGCCTCGGCCTGCGCCTCACCCTGTCCATCGGCGGCCTCGGCTAT
TGCATCTACAGCGCCTCCTTCCTCTCCTACTCCCACACCCAGAACGTCGGCTTCGTCATCTTCTCCGGCGCCTTC
CTCGGCCTCTGCGCCGGCCTGCTCTGGACCGCTCAGGGCGCCATCATGATGTCCTACCCGCCCGAGAACAGCAAG
GGCCGCTACATCTCCTGGTTCTGGATCATCTTCAATCTCGGCGCCGTCATCGGCTCCTTGATTCCGCTCGCGCAA
AACGTCAACAAGAAGGCCGGTCCCGTCACCGACGGCACTTACATCGCCTTCATCATCCTCATGTTCATCGGCGCC
TGCCTGTCCCTCATGCTGGTCGACGCCAACAAGGTGATCCGCGAGGACAACACCAAGGTCATCCTGATGAAAAAC
CCGTCCTGGCTGAGCGAGTTCAAGGGCCTTTGGGAGACGCTCTTCAACGAGCCCTGGATCCTGCTGCTCTTCCCC
ATGTTCTTCGCCTCCAACTTCTTCTACACCTACCAGAACAACGACATGAACGCCGCCCACTTCAACACCCGCACC
CGAGCCCTCAACAACCTCCTCTACTGGTTGGCCCAGATCTTCGGCGCCATCCTCATGGGCTACTGTCTCGACATC
CACACCATCCGCCGCAGCGTCCGCGGCAAGATCGCCTTTGGCTTCCTCGTCGCCCTGACCTTCATCATCTGGGGC
GGCGGCTGGCACTGGCAGAAGCAGCAGGTCTCTCGCCAGGTGGCCGAGAGCAAGGACTACCCCGGCCTCGTCGAC
TGGACCGACGGCGGCACCCGTTTCGTCGGGCCCATGTTCCTCTATTTCTTCTACGGCTTCTACGACGCCATCTGG
CAGACCAGCATCTACTGGTTCATGGGGTCCCTGTCGAACTCGGGTCGCAAGGCCGCCAACCTGGCCGGCTTCTAC
AAGTCGATCCAGTCGTTCGGTGCCAGCATAGCCTACTACCTGGACGGGAGCAAGAAGGACTACAACACCATCTTC
GGGCTGACGTGGGGCCTGCTGGCCGGCTCCTTACTGTTTGCGCTGCCCGTCATCCTGTTTAAGATCAAGGACCAC
GTGTCGATGGAGGACGACCTCAAGTTCAGCGACGAGACGATCGACGACGTGGTCGTGGGGGCGACGGAGAAGGCG
GACCAGCCACACGTGTGA
Transcript >Hirsu2|10978
ATGTCTTCCGACCAGGCCAAGGCCGGCCACGAGATGGCCGTCGATGAGGCCACCCGCCAAACCCCTCCCGACTAC
GTCGACTTCGTCGACCGCCCCCCCGGCCTCCTGTACAAGCCATTCCGCCTCTTCGGCCGTGAGGTCTGGTATGCC
TCGCCCAAGGTCCAGCTCCTCATGGTCTCCCTCGTCTGCTTCCTCTGTCCCGGCATGTACAACTCCCTCACCGGC
CTCGGCGGCGGCGGCCAGGTCGACGCCACCGCCCAAGACCACGCCAACGTCGCCCTCTACAGCACCTTCGCCGTC
GTCGGCTTCTTCGCCGGCACCTTCGCCAACCGCCTCGGCCTGCGCCTCACCCTGTCCATCGGCGGCCTCGGCTAT
TGCATCTACAGCGCCTCCTTCCTCTCCTACTCCCACACCCAGAACGTCGGCTTCGTCATCTTCTCCGGCGCCTTC
CTCGGCCTCTGCGCCGGCCTGCTCTGGACCGCTCAGGGCGCCATCATGATGTCCTACCCGCCCGAGAACAGCAAG
GGCCGCTACATCTCCTGGTTCTGGATCATCTTCAATCTCGGCGCCGTCATCGGCTCCTTGATTCCGCTCGCGCAA
AACGTCAACAAGAAGGCCGGTCCCGTCACCGACGGCACTTACATCGCCTTCATCATCCTCATGTTCATCGGCGCC
TGCCTGTCCCTCATGCTGGTCGACGCCAACAAGGTGATCCGCGAGGACAACACCAAGGTCATCCTGATGAAAAAC
CCGTCCTGGCTGAGCGAGTTCAAGGGCCTTTGGGAGACGCTCTTCAACGAGCCCTGGATCCTGCTGCTCTTCCCC
ATGTTCTTCGCCTCCAACTTCTTCTACACCTACCAGAACAACGACATGAACGCCGCCCACTTCAACACCCGCACC
CGAGCCCTCAACAACCTCCTCTACTGGTTGGCCCAGATCTTCGGCGCCATCCTCATGGGCTACTGTCTCGACATC
CACACCATCCGCCGCAGCGTCCGCGGCAAGATCGCCTTTGGCTTCCTCGTCGCCCTGACCTTCATCATCTGGGGC
GGCGGCTGGCACTGGCAGAAGCAGCAGGTCTCTCGCCAGGTGGCCGAGAGCAAGGACTACCCCGGCCTCGTCGAC
TGGACCGACGGCGGCACCCGTTTCGTCGGGCCCATGTTCCTCTATTTCTTCTACGGCTTCTACGACGCCATCTGG
CAGACCAGCATCTACTGGTTCATGGGGTCCCTGTCGAACTCGGGTCGCAAGGCCGCCAACCTGGCCGGCTTCTAC
AAGTCGATCCAGTCGTTCGGTGCCAGCATAGCCTACTACCTGGACGGGAGCAAGAAGGACTACAACACCATCTTC
GGGCTGACGTGGGGCCTGCTGGCCGGCTCCTTACTGTTTGCGCTGCCCGTCATCCTGTTTAAGATCAAGGACCAC
GTGTCGATGGAGGACGACCTCAAGTTCAGCGACGAGACGATCGACGACGTGGTCGTGGGGGCGACGGAGAAGGCG
GACCAGCCACACGTGTGA
Gene >Hirsu2|10978
ATGTCTTCCGACCAGGCCAAGGCCGGCCACGAGATGGCCGTCGATGAGGCCACCCGCCAAACCCCTCCCGACTAC
GTCGACTTCGTCGACCGCCCCCCCGGCCTCCTGTACAAGCCATTCCGCCTCTTCGGCCGTGAGGTCTGGTATGCC
TCGCCCAAGGTCCAGCTCCTCATGGTCTCCCTCGTCTGCTTCCTCTGTCCCGGCATGTACAACTCCCTCACCGGC
CTCGGCGGCGGCGGCCAGGTCGACGCCACCGCCCAAGACCACGCCAACGTCGCCCTCTACAGCACCTTCGCCGTC
GTCGGCTTCTTCGCCGGCACCTTCGCCAACCGCCTCGGCCTGCGCCTCACCCTGTCCATCGGCGGCCTCGGCTAT
TGCATCTACAGCGCCTCCTTCCTCTCCTACTCCCACACCCAGAACGTCGGCTTCGTCATCTTCTCCGGCGCCTTC
CTCGGCCTCTGCGCCGGCCTGCTCTGGACCGCTCAGGGCGCCATCATGATGTCCTACCCGCCCGAGAACAGCAAG
GGCCGCTACATCTCCTGGTTCTGGATCATCTTCAATCTCGGCGCCGTCATCGGCTCCTTGGTACGTCCCCCCTCC
CCTTCAGAAACCTGGTGCGTGCGGCCCGGACCTCCTAACCTGGCTCCTCCGCGCGCCCGGCCCCCAATCTAGATT
CCGCTCGCGCAAAACGTCAACAAGAAGGCCGGTCCCGTCACCGACGGCACTTACATCGCCTTCATCATCCTCATG
TTCATCGGCGCCTGCCTGTCCCTCATGCTGGTCGACGCCAACAAGGTGATCCGCGAGGACAACACCAAGGTCATC
CTGATGAAAAACCCGTCCTGGCTGAGCGAGTTCAAGGGCCTTTGGGAGACGCTCTTCAACGAGCCCTGGATCCTG
CTGCTCTTCCCCATGTTCTTCGCCTCCAACTTCTTCTACACCTACCAGAACAACGACATGAACGCCGCCCACTTC
AACACCCGCACCCGAGCCCTCAACAACCTCCTCTACTGGTTGGCCCAGATCTTCGGCGCCATCCTCATGGGCTAC
TGTCTCGACATCCACACCATCCGCCGCAGCGTCCGCGGCAAGATCGCCTTTGGCTTCCTCGTCGCCCTGACCTTC
ATCATCTGGGGCGGCGGCTGGCACTGGCAGAAGCAGCAGGTCTCTCGCCAGGTGGCCGAGAGCAAGGACTACCCC
GGCCTCGTCGACTGGACCGACGGCGGCACCCGTTTCGTCGGGCCCATGTTCCTCTATTTCTTCTACGGCTTCTAC
GACGCCATCTGGCAGACCAGCATCTACTGGTACGTCCCCTTCGCCGCCGGTGATTTTTCTTTTAGGGGGGGGGGG
GGAAACCCGAGAGTGGAGTCGCTAACGGACGGTGTTGATAGGTTCATGGGGTCCCTGTCGAACTCGGGTCGCAAG
GCCGCCAACCTGGCCGGTGAGTGGAAAGCAAGGAAGCGGAGCGCGCCGCCGACGCTGACTCGACCTCGCAGGCTT
CTACAAGTCGATCCAGTCGTTCGGTGCCAGCATAGCCTACTACCTGGACGGGAGCAAGAAGGACTACAACACCAT
CTTCGGGCTGACGTGGGGCCTGCTGGCCGGCTCCTTACTGTTTGCGCTGCCCGTCATCCTGTTTAAGATCAAGGA
CCACGTGTCGATGGAGGACGACCTCAAGTTCAGCGACGAGACGATCGACGACGTGGTCGTGGGGGCGACGGAGAA
GGCGGACCAGCCACACGTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail