Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10976
Gene name
LocationContig_939:4456..7199
Strand-
Gene length (bp)2743
Transcript length (bp)2382
Coding sequence length (bp)2382
Protein length (aa) 794

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain 6.7E-42 93 338
PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain 2.2E-34 387 661
PF14310 Fn3-like Fibronectin type III-like domain 2.8E-21 716 782

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2UDK7|BGLM_ASPOR Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglM PE=3 SV=1 6 789 0.0E+00
sp|A1D122|BGLM_NEOFI Probable beta-glucosidase M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglM PE=3 SV=1 29 793 0.0E+00
sp|B8N5S6|BGLM_ASPFN Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglM PE=3 SV=1 6 789 0.0E+00
sp|Q4WR62|BGLM_ASPFU Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglM PE=3 SV=1 29 793 0.0E+00
sp|B0XPB8|BGLM_ASPFC Probable beta-glucosidase M OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglM PE=3 SV=1 29 793 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2UDK7|BGLM_ASPOR Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglM PE=3 SV=1 6 789 0.0E+00
sp|A1D122|BGLM_NEOFI Probable beta-glucosidase M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglM PE=3 SV=1 29 793 0.0E+00
sp|B8N5S6|BGLM_ASPFN Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglM PE=3 SV=1 6 789 0.0E+00
sp|Q4WR62|BGLM_ASPFU Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglM PE=3 SV=1 29 793 0.0E+00
sp|B0XPB8|BGLM_ASPFC Probable beta-glucosidase M OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglM PE=3 SV=1 29 793 0.0E+00
sp|Q0C7L4|BGLM_ASPTN Probable beta-glucosidase M OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglM PE=3 SV=1 5 789 0.0E+00
sp|A5ABF5|BGLM_ASPNC Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglM PE=3 SV=1 26 789 0.0E+00
sp|Q5AWD4|BGLM_EMENI Probable beta-glucosidase M OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglM PE=3 SV=1 29 788 0.0E+00
sp|G4N7Z0|CEL3B_MAGO7 Beta-glucosidase cel3A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel3B PE=1 SV=1 39 793 0.0E+00
sp|Q5B0F4|BGLG_EMENI Probable beta-glucosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglG PE=3 SV=2 36 785 0.0E+00
sp|Q2U325|BGLG_ASPOR Probable beta-glucosidase G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglG PE=3 SV=1 36 785 0.0E+00
sp|B8NMR5|BGLG_ASPFN Probable beta-glucosidase G OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglG PE=3 SV=1 36 785 0.0E+00
sp|Q0CUC1|BGLG_ASPTN Probable beta-glucosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglG PE=3 SV=1 36 785 0.0E+00
sp|A1DC16|BGLG_NEOFI Probable beta-glucosidase G OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglG PE=3 SV=1 36 785 0.0E+00
sp|A1DCV5|BGLL_NEOFI Probable beta-glucosidase L OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglL PE=3 SV=1 50 793 0.0E+00
sp|Q4WGT3|BGLL_ASPFU Probable beta-glucosidase L OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglL PE=3 SV=1 50 793 2.0E-180
sp|B0YB65|BGLL_ASPFC Probable beta-glucosidase L OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglL PE=3 SV=1 50 793 2.0E-180
sp|Q0CEF3|BGLL_ASPTN Probable beta-glucosidase L OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglL PE=3 SV=1 53 789 3.0E-176
sp|Q5B9F2|BGLL_EMENI Probable beta-glucosidase L OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglL PE=3 SV=1 53 789 6.0E-170
sp|G4NI45|CEL3A_MAGO7 Beta-glucosidase cel3A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel3A PE=1 SV=1 53 793 8.0E-170
sp|A1CR85|BGLA_ASPCL Probable beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglA PE=3 SV=1 35 788 4.0E-160
sp|A1D451|BGLA_NEOFI Probable beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglA PE=3 SV=1 8 788 5.0E-159
sp|B0XPE1|BGLA_ASPFC Probable beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglA PE=3 SV=1 8 788 6.0E-158
sp|P48825|BGL1_ASPAC Beta-glucosidase 1 OS=Aspergillus aculeatus PE=1 SV=1 19 676 2.0E-148
sp|P87076|BGLA_ASPKW Beta-glucosidase A OS=Aspergillus kawachii (strain NBRC 4308) GN=bglA PE=1 SV=2 39 676 2.0E-146
sp|A2RAL4|BGLA_ASPNC Probable beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglA PE=3 SV=1 39 676 2.0E-145
sp|Q2UUD6|BGLA_ASPOR Probable beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglA PE=3 SV=1 39 681 4.0E-145
sp|B8NRX2|BGLA_ASPFN Probable beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglA PE=3 SV=1 39 681 6.0E-145
sp|D4AN50|BGLA_ARTBC Probable beta-glucosidase ARB_05654 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05654 PE=1 SV=1 38 676 1.0E-143
sp|D0VKF5|BGLA_ASPTE Probable beta-glucosidase A OS=Aspergillus terreus GN=bglA PE=2 SV=1 39 672 2.0E-143
sp|Q0CTD7|BGLA_ASPTN Probable beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglA PE=3 SV=1 9 672 3.0E-143
sp|Q4WD56|BGLE_ASPFU Probable beta-glucosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglE PE=3 SV=1 43 789 3.0E-142
sp|B0YD91|BGLE_ASPFC Probable beta-glucosidase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglE PE=3 SV=1 43 789 3.0E-142
sp|Q5B5S8|BGLA_EMENI Probable beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglA PE=3 SV=2 51 676 4.0E-142
sp|Q4WJJ3|BGLA_ASPFU Probable beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglA PE=3 SV=1 8 676 6.0E-141
sp|A1CMH6|BGLE_ASPCL Probable beta-glucosidase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglE PE=3 SV=1 43 676 2.0E-140
sp|P22506|BGL1_SACFI Beta-glucosidase 1 OS=Saccharomycopsis fibuligera GN=BGL1 PE=3 SV=1 5 779 2.0E-140
sp|Q0CI67|BGLF_ASPTN Probable beta-glucosidase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglF PE=3 SV=1 11 768 2.0E-137
sp|Q2UTX5|BGLE_ASPOR Probable beta-glucosidase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglE PE=3 SV=2 43 675 4.0E-137
sp|A2QPK4|BGLD_ASPNC Probable beta-glucosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglD PE=3 SV=2 29 793 6.0E-135
sp|A1DMR8|BGLF_NEOFI Probable beta-glucosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglF PE=3 SV=1 39 667 3.0E-134
sp|A1DLJ5|BGLE_NEOFI Probable beta-glucosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglE PE=3 SV=1 43 683 5.0E-134
sp|B0Y7Q8|BGLF_ASPFC Probable beta-glucosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglF PE=3 SV=2 39 701 7.0E-134
sp|Q4WMU3|BGLF_ASPFU Probable beta-glucosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglF PE=3 SV=2 39 768 7.0E-134
sp|Q5B6C6|BGLF_EMENI Probable beta-glucosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglF PE=3 SV=2 31 667 1.0E-133
sp|Q5AYH8|BGLE_EMENI Probable beta-glucosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglE PE=3 SV=1 43 675 1.0E-131
sp|B8NJF4|BGLD_ASPFN Probable beta-glucosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglD PE=3 SV=2 51 793 3.0E-130
sp|Q2UNR0|BGLD_ASPOR Probable beta-glucosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglD PE=3 SV=1 51 793 7.0E-130
sp|Q2UN12|BGLF_ASPOR Probable beta-glucosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglF PE=3 SV=1 39 678 5.0E-129
sp|B8NP65|BGLF_ASPFN Probable beta-glucosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglF PE=3 SV=1 39 678 5.0E-129
sp|P22507|BGL2_SACFI Beta-glucosidase 2 OS=Saccharomycopsis fibuligera GN=BGL2 PE=3 SV=1 39 668 3.0E-124
sp|P06835|BGLS_WICAO Beta-glucosidase OS=Wickerhamomyces anomalus PE=3 SV=1 1 683 5.0E-123
sp|Q5B681|BGLN_EMENI Probable beta-glucosidase N OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglN PE=3 SV=1 222 793 1.0E-107
sp|Q5AUW5|BGLD_EMENI Probable beta-glucosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglD PE=3 SV=2 224 789 7.0E-99
sp|P14002|BGLB_CLOTH Thermostable beta-glucosidase B OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=bglB PE=1 SV=2 61 793 9.0E-90
sp|F6C6C1|APY_BIFBA Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) GN=HMPREF9228_1477 PE=1 SV=1 64 785 2.0E-72
sp|E7CY69|APY_BIFLN Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum GN=apy PE=1 SV=1 64 785 1.0E-66
sp|A7LXS8|BGH3A_BACO1 Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02644 PE=1 SV=1 5 785 7.0E-60
sp|P27034|BGLS_RHIRD Beta-glucosidase OS=Rhizobium radiobacter GN=cbg-1 PE=3 SV=1 62 400 4.0E-47
sp|A1DFA8|BGLI_NEOFI Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglI PE=3 SV=1 64 426 4.0E-42
sp|Q4WU49|BGLI_ASPFU Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglI PE=3 SV=1 64 426 2.0E-41
sp|B0Y3M6|BGLI_ASPFC Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglI PE=3 SV=1 64 426 4.0E-41
sp|Q5BFG8|BGLB_EMENI Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglB PE=1 SV=1 58 413 4.0E-41
sp|Q5BB53|BGLI_EMENI Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglI PE=2 SV=2 64 426 7.0E-41
sp|Q0CAF5|BGLI_ASPTN Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglI PE=3 SV=1 64 425 1.0E-40
sp|Q2U8Y5|BGLI_ASPOR Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglI PE=3 SV=1 64 426 4.0E-40
sp|B8NDE2|BGLI_ASPFN Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglI PE=3 SV=2 64 426 6.0E-40
sp|A1CA51|BGLI_ASPCL Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglI PE=3 SV=1 66 426 2.0E-39
sp|Q5AV15|BGLJ_EMENI Probable beta-glucosidase J OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglJ PE=3 SV=1 35 406 6.0E-39
sp|A2R989|BGLI_ASPNC Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglI PE=3 SV=1 92 601 4.0E-38
sp|A1DNN8|BGLJ_NEOFI Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglJ PE=3 SV=1 59 337 1.0E-35
sp|Q4WLY1|BGLJ_ASPFU Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglJ PE=3 SV=2 59 337 2.0E-35
sp|B0Y8M8|BGLJ_ASPFC Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglJ PE=3 SV=2 59 337 2.0E-35
sp|Q2U9M7|BGLH_ASPOR Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglH PE=3 SV=2 63 425 3.0E-35
sp|B8NPL7|BGLH_ASPFN Probable beta-glucosidase H OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglH PE=3 SV=1 63 425 3.0E-35
sp|A7LXU3|BGH3B_BACO1 Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02659 PE=1 SV=1 92 781 6.0E-35
sp|Q5B6C7|BGLH_EMENI Probable beta-glucosidase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglH PE=3 SV=2 63 424 3.0E-34
sp|Q56078|BGLX_SALTY Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=bglX PE=3 SV=2 89 782 6.0E-34
sp|A1CUR8|BGLH_ASPCL Probable beta-glucosidase H OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglH PE=3 SV=1 63 424 1.0E-33
sp|Q5BA18|BGLK_EMENI Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglK PE=2 SV=1 71 337 3.0E-33
sp|Q9P6J6|BGLS_SCHPO Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.04 PE=3 SV=1 60 347 4.0E-33
sp|P33363|BGLX_ECOLI Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) GN=bglX PE=1 SV=2 89 793 9.0E-33
sp|P07337|BGLS_KLUMA Beta-glucosidase OS=Kluyveromyces marxianus PE=3 SV=1 63 426 7.0E-32
sp|A1DPG0|BGLH_NEOFI Probable beta-glucosidase H OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglH PE=3 SV=1 63 425 2.0E-31
sp|Q4WA69|BGLK_ASPFU Probable beta-glucosidase K OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglK PE=3 SV=1 63 337 2.0E-31
sp|B0XM94|BGLH_ASPFC Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglH PE=3 SV=1 63 425 1.0E-30
sp|Q4WL79|BGLH_ASPFU Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglH PE=3 SV=1 63 425 2.0E-30
sp|Q9LXD6|BXL3_ARATH Beta-D-xylosidase 3 OS=Arabidopsis thaliana GN=BXL3 PE=1 SV=1 38 787 2.0E-27
sp|A1DNN8|BGLJ_NEOFI Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglJ PE=3 SV=1 513 776 1.0E-25
sp|Q4WLY1|BGLJ_ASPFU Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglJ PE=3 SV=2 513 776 1.0E-24
sp|Q94KD8|BXL2_ARATH Probable beta-D-xylosidase 2 OS=Arabidopsis thaliana GN=BXL2 PE=2 SV=1 59 788 1.0E-24
sp|B0Y8M8|BGLJ_ASPFC Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglJ PE=3 SV=2 513 776 2.0E-24
sp|Q2U9M7|BGLH_ASPOR Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglH PE=3 SV=2 510 793 2.0E-24
sp|B8NPL7|BGLH_ASPFN Probable beta-glucosidase H OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglH PE=3 SV=1 510 793 2.0E-24
sp|P29091|BGLS_SCHCO Beta-glucosidase (Fragment) OS=Schizophyllum commune PE=2 SV=1 536 655 2.0E-24
sp|Q9FLG1|BXL4_ARATH Beta-D-xylosidase 4 OS=Arabidopsis thaliana GN=BXL4 PE=1 SV=1 59 788 4.0E-24
sp|P15885|BGLS_RUMAL Beta-glucosidase OS=Ruminococcus albus PE=3 SV=1 65 338 5.0E-24
sp|Q5B6C7|BGLH_EMENI Probable beta-glucosidase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglH PE=3 SV=2 513 793 6.0E-24
sp|A1DPG0|BGLH_NEOFI Probable beta-glucosidase H OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglH PE=3 SV=1 510 789 2.0E-23
sp|P16084|BGLS_BUTFI Beta-glucosidase A OS=Butyrivibrio fibrisolvens GN=bglA PE=3 SV=1 538 787 2.0E-23
sp|Q9LJN4|BXL5_ARATH Probable beta-D-xylosidase 5 OS=Arabidopsis thaliana GN=BXL5 PE=2 SV=2 58 737 2.0E-23
sp|Q4WU49|BGLI_ASPFU Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglI PE=3 SV=1 510 778 6.0E-23
sp|B0Y3M6|BGLI_ASPFC Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglI PE=3 SV=1 518 778 1.0E-22
sp|Q9FGY1|BXL1_ARATH Beta-D-xylosidase 1 OS=Arabidopsis thaliana GN=BXL1 PE=1 SV=1 57 748 1.0E-22
sp|Q5BB53|BGLI_EMENI Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglI PE=2 SV=2 441 778 2.0E-22
sp|Q2U8Y5|BGLI_ASPOR Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglI PE=3 SV=1 511 778 2.0E-22
sp|B0XM94|BGLH_ASPFC Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglH PE=3 SV=1 510 789 2.0E-22
sp|Q4WL79|BGLH_ASPFU Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglH PE=3 SV=1 510 789 2.0E-22
sp|Q23892|GLUA_DICDI Lysosomal beta glucosidase OS=Dictyostelium discoideum GN=gluA PE=1 SV=2 118 788 2.0E-22
sp|P16084|BGLS_BUTFI Beta-glucosidase A OS=Butyrivibrio fibrisolvens GN=bglA PE=3 SV=1 61 330 3.0E-22
sp|B8NDE2|BGLI_ASPFN Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglI PE=3 SV=2 511 778 5.0E-22
sp|Q5BA18|BGLK_EMENI Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglK PE=2 SV=1 569 793 8.0E-22
sp|A5JTQ3|XYL2_MEDSV Beta-xylosidase/alpha-L-arabinofuranosidase 2 OS=Medicago sativa subsp. varia GN=Xyl2 PE=2 SV=1 58 776 8.0E-22
sp|Q5AV15|BGLJ_EMENI Probable beta-glucosidase J OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglJ PE=3 SV=1 513 785 4.0E-21
sp|Q5BFG8|BGLB_EMENI Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglB PE=1 SV=1 498 793 5.0E-21
sp|A2R989|BGLI_ASPNC Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglI PE=3 SV=1 513 778 6.0E-21
sp|Q0CAF5|BGLI_ASPTN Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglI PE=3 SV=1 511 778 7.0E-21
sp|A1DFA8|BGLI_NEOFI Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglI PE=3 SV=1 520 778 1.0E-20
sp|A1CA51|BGLI_ASPCL Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglI PE=3 SV=1 511 778 1.0E-20
sp|A1CUR8|BGLH_ASPCL Probable beta-glucosidase H OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglH PE=3 SV=1 510 789 3.0E-20
sp|A1DJS5|XYND_NEOFI Probable exo-1,4-beta-xylosidase xlnD OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnD PE=3 SV=1 59 753 6.0E-20
sp|P27034|BGLS_RHIRD Beta-glucosidase OS=Rhizobium radiobacter GN=cbg-1 PE=3 SV=1 520 793 1.0E-19
sp|B0YBJ3|BGLK_ASPFC Probable beta-glucosidase K OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglK PE=3 SV=1 63 337 2.0E-19
sp|Q9P6J6|BGLS_SCHPO Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.04 PE=3 SV=1 513 793 3.0E-19
sp|Q0CB82|BXLB_ASPTN Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bxlB PE=3 SV=1 36 753 3.0E-19
sp|Q5BAS1|XYND_EMENI Exo-1,4-beta-xylosidase xlnD OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnD PE=1 SV=1 59 761 9.0E-19
sp|Q2UUD6|BGLA_ASPOR Probable beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglA PE=3 SV=1 689 788 1.0E-18
sp|B8NRX2|BGLA_ASPFN Probable beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglA PE=3 SV=1 689 788 1.0E-18
sp|D0VKF5|BGLA_ASPTE Probable beta-glucosidase A OS=Aspergillus terreus GN=bglA PE=2 SV=1 690 789 1.0E-18
sp|O00089|XYND_ASPNG Exo-1,4-beta-xylosidase xlnD OS=Aspergillus niger GN=xlnD PE=1 SV=2 54 741 1.0E-18
sp|A2QA27|XYND_ASPNC Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xlnD PE=3 SV=1 54 741 1.0E-18
sp|Q0CTD7|BGLA_ASPTN Probable beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglA PE=3 SV=1 690 789 2.0E-18
sp|Q4WJJ3|BGLA_ASPFU Probable beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglA PE=3 SV=1 690 788 1.0E-17
sp|P07337|BGLS_KLUMA Beta-glucosidase OS=Kluyveromyces marxianus PE=3 SV=1 458 785 3.0E-17
sp|P15885|BGLS_RUMAL Beta-glucosidase OS=Ruminococcus albus PE=3 SV=1 535 784 3.0E-17
sp|D5EY15|XYL3A_PRER2 Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) GN=xyl3A PE=1 SV=1 56 400 3.0E-17
sp|Q4AEG8|XYND_ASPAW Exo-1,4-beta-xylosidase xlnD OS=Aspergillus awamori GN=xlnD PE=2 SV=1 54 667 4.0E-17
sp|Q5B5S8|BGLA_EMENI Probable beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglA PE=3 SV=2 689 788 6.0E-17
sp|Q9SGZ5|BXL7_ARATH Probable beta-D-xylosidase 7 OS=Arabidopsis thaliana GN=BXL7 PE=2 SV=2 59 787 1.0E-16
sp|B6EY09|XYND_ASPJA Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus japonicus GN=xlnD PE=1 SV=1 38 667 2.0E-16
sp|A5JTQ2|XYL1_MEDSV Beta-xylosidase/alpha-L-arabinofuranosidase 1 (Fragment) OS=Medicago sativa subsp. varia GN=Xyl1 PE=1 SV=1 59 406 3.0E-16
sp|Q4WRB0|XYND_ASPFU Probable exo-1,4-beta-xylosidase xlnD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnD PE=2 SV=1 57 753 4.0E-16
sp|B0XP71|XYND_ASPFC Probable exo-1,4-beta-xylosidase xlnD OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnD PE=3 SV=1 57 753 5.0E-16
sp|P48825|BGL1_ASPAC Beta-glucosidase 1 OS=Aspergillus aculeatus PE=1 SV=1 673 791 6.0E-16
sp|D5EY15|XYL3A_PRER2 Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) GN=xyl3A PE=1 SV=1 483 790 6.0E-16
sp|Q5AYH8|BGLE_EMENI Probable beta-glucosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglE PE=3 SV=1 689 787 2.0E-15
sp|A1CMH6|BGLE_ASPCL Probable beta-glucosidase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglE PE=3 SV=1 695 788 3.0E-15
sp|P40406|NAGZ_BACSU Beta-hexosaminidase OS=Bacillus subtilis (strain 168) GN=nagZ PE=1 SV=1 68 338 4.0E-15
sp|C0STH4|XYND_ASPAC Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus aculeatus GN=xlnD PE=3 SV=1 38 667 1.0E-14
sp|Q5ATH9|BXLB_EMENI Exo-1,4-beta-xylosidase bxlB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bxlB PE=1 SV=1 59 408 3.0E-14
sp|P87076|BGLA_ASPKW Beta-glucosidase A OS=Aspergillus kawachii (strain NBRC 4308) GN=bglA PE=1 SV=2 695 788 7.0E-14
sp|Q5AUW5|BGLD_EMENI Probable beta-glucosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglD PE=3 SV=2 51 213 1.0E-13
sp|Q2UTX5|BGLE_ASPOR Probable beta-glucosidase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglE PE=3 SV=2 681 789 2.0E-13
sp|A2RAL4|BGLA_ASPNC Probable beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglA PE=3 SV=1 695 788 3.0E-13
sp|P22507|BGL2_SACFI Beta-glucosidase 2 OS=Saccharomycopsis fibuligera GN=BGL2 PE=3 SV=1 690 779 9.0E-13
sp|A1DLJ5|BGLE_NEOFI Probable beta-glucosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglE PE=3 SV=1 695 789 9.0E-12
sp|Q5BG51|BGLO_EMENI Probable beta-glucosidase O OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglO PE=3 SV=1 208 607 2.0E-11
sp|Q5B6C6|BGLF_EMENI Probable beta-glucosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglF PE=3 SV=2 690 785 6.0E-11
sp|A1DMR8|BGLF_NEOFI Probable beta-glucosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglF PE=3 SV=1 681 768 1.0E-10
sp|Q5BCC6|BGLC_EMENI Beta-glucosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglC PE=1 SV=1 47 401 1.0E-10
sp|P29090|BGL3_ASPWE Beta-glucosidase A-3 (Fragment) OS=Aspergillus wentii PE=1 SV=1 275 328 4.0E-10
sp|A1CCL9|BXLB_ASPCL Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bxlB PE=3 SV=2 59 408 4.0E-09
sp|Q4WFI6|BXLB_ASPFU Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bxlB PE=3 SV=1 518 779 6.0E-09
sp|B0Y0I4|BXLB_ASPFC Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bxlB PE=3 SV=1 518 779 6.0E-09
sp|B8NGU6|BGLC_ASPFN Probable beta-glucosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglC PE=3 SV=1 10 407 7.0E-09
sp|B8NYD8|BXLB_ASPFN Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bxlB PE=3 SV=1 58 408 4.0E-08
sp|Q2TYT2|BXLB_ASPOR Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bxlB PE=3 SV=1 58 408 6.0E-08
sp|A1CND4|XYND_ASPCL Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xlnD PE=3 SV=2 57 285 7.0E-08
sp|P83344|XYNB_PRUPE Putative beta-D-xylosidase (Fragment) OS=Prunus persica PE=2 SV=1 523 788 9.0E-08
sp|Q4WFI6|BXLB_ASPFU Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bxlB PE=3 SV=1 59 288 2.0E-07
sp|B0Y0I4|BXLB_ASPFC Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bxlB PE=3 SV=1 59 288 2.0E-07
sp|Q0CMH8|XYND_ASPTN Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnD PE=3 SV=2 57 408 2.0E-07
sp|B8NYD8|BXLB_ASPFN Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bxlB PE=3 SV=1 538 780 3.0E-07
sp|Q2TYT2|BXLB_ASPOR Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bxlB PE=3 SV=1 538 780 3.0E-07
sp|A1CND4|XYND_ASPCL Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xlnD PE=3 SV=2 510 761 3.0E-07
sp|Q2UFP8|BGLC_ASPOR Probable beta-glucosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglC PE=3 SV=2 94 407 5.0E-07
sp|Q0CMH8|XYND_ASPTN Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnD PE=3 SV=2 538 761 2.0E-06
sp|Q7WUL3|NAG3_CELFI Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi GN=nag3 PE=1 SV=1 120 413 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10976
MFQPLLSGLAVLAALPAVAAAVQNGSRPIGDDGHFFGQSPPVYPSPPMTGGAWAGAYARARDLVGRMTLEEKVSL
TGGADVGSGCSGSVPPIQRLGFPGMCLTDNGNGVRNTDLVNSYPSGIHVGASWNKVLARARGSAMGAEFRRKGVN
VMLGPVVGPAWRVPRSGRNWEGFSVDPYLAGSLVAESVLATQAEGVQTSVKHYIANEQESYRTPVGLTEAVSSNI
DDRTMHEVYLWPFQDAVRAGAANIMCSYQRINNSYGCANSKTLNGLLKTELGFQGFVVSDWGAQHTGVASALAGM
DMAMPSGNGYWGEKLVEAVKNGSVPESRVDDMATRIITTWYQFRQDTLFPRPGIGMPKALTEPHAAVDGRDAGAL
PIIYQGALEGHVLVKNTKATLPLRRPRMLSLFGYSAKSPDTSNPSSAVLDSLAWAVGAQTIARDEFLAGLAPFSP
NTSYPAIGKRGALITGCGSGATTAAVFTAPFESLKLRAAREDTALFYDFDSASPSVNPLTDACIVFGNAWACEGY
DRPGLSDDYTDGLIKKVAGQCAKTIVVFHNAGVRLVEAFADHPNVTAIIFAHLPGRDSGEALVSLLYGHSAPSGK
LPYTVARKASDYGDGLDPAGPRGRYARFPQSDFSEGTYLDYKHLDDRGIEPRYEFGFGLSYTTFSLSGLYIQPLR
AFNMGPFPVGPVVAGGPSDLWEPMAYVSATVRNTGAAPGAEVAQLYVGIPGGPPRQLRGFEKRYLVPGQQQVVTF
RLTRRDLSTWDAGAQAWRLERGPFHIYVGNSSRNLPLKGIIQL*
Coding >Hirsu2|10976
ATGTTCCAGCCTCTGCTCTCCGGCCTCGCCGTCCTGGCCGCCCTGCCGGCCGTGGCGGCGGCCGTCCAGAACGGC
AGCCGCCCGATCGGCGACGACGGCCATTTCTTCGGCCAGTCGCCGCCCGTCTACCCCTCTCCGCCCATGACGGGG
GGGGCCTGGGCCGGCGCCTACGCCCGGGCTAGGGACCTGGTCGGCCGGATGACGCTCGAGGAGAAGGTCAGCCTC
ACCGGCGGCGCCGACGTCGGCTCCGGCTGCAGCGGCTCCGTCCCGCCCATCCAGCGGCTCGGCTTCCCGGGCATG
TGCCTCACCGACAACGGCAACGGCGTGCGGAACACGGACCTGGTCAACTCGTACCCGAGCGGCATCCACGTCGGC
GCCAGCTGGAACAAGGTGCTCGCCCGCGCGCGCGGCTCCGCCATGGGCGCCGAGTTCCGGAGAAAGGGCGTCAAC
GTCATGCTCGGCCCCGTCGTCGGCCCCGCCTGGCGCGTTCCCCGCAGCGGCCGCAACTGGGAGGGCTTCTCCGTC
GACCCCTACCTGGCCGGCTCGCTCGTCGCCGAGAGCGTCCTGGCCACCCAGGCCGAGGGCGTCCAGACGAGCGTC
AAGCACTACATCGCCAACGAGCAAGAGTCGTACCGCACGCCCGTCGGCCTCACCGAGGCCGTCTCCTCCAACATT
GACGACAGGACCATGCACGAGGTCTATCTCTGGCCCTTTCAGGATGCGGTCAGAGCCGGGGCCGCCAACATCATG
TGCTCGTACCAGCGCATCAACAACTCGTACGGCTGCGCCAACAGCAAGACGCTCAACGGCCTGCTCAAGACCGAG
CTCGGCTTTCAGGGCTTCGTCGTGTCCGATTGGGGCGCCCAGCACACCGGCGTCGCCAGCGCTCTGGCCGGCATG
GACATGGCCATGCCCAGCGGGAACGGCTACTGGGGCGAGAAGCTCGTCGAGGCGGTCAAGAACGGCTCGGTGCCG
GAATCGCGCGTCGACGACATGGCGACGAGGATCATCACGACCTGGTACCAGTTCCGCCAAGACACCCTCTTCCCC
CGCCCGGGCATCGGCATGCCCAAGGCCCTGACGGAGCCGCACGCAGCCGTGGACGGGCGCGACGCCGGCGCCCTG
CCCATCATCTACCAGGGCGCCCTGGAGGGCCACGTGCTCGTCAAGAACACCAAGGCGACGCTCCCGCTGCGCCGG
CCGCGCATGCTGTCCCTGTTCGGCTACTCGGCCAAGTCGCCCGACACGTCCAACCCCAGCTCCGCCGTGCTGGAC
AGCCTGGCCTGGGCCGTCGGCGCGCAGACGATCGCCAGGGACGAGTTCTTGGCCGGCCTCGCCCCCTTCAGCCCC
AACACGAGCTACCCTGCCATCGGCAAGCGGGGCGCGCTCATCACCGGCTGCGGCTCCGGCGCCACCACCGCGGCC
GTCTTCACCGCGCCCTTCGAGTCGCTCAAGCTCCGGGCCGCGCGCGAGGACACGGCCCTCTTCTACGACTTCGAC
TCGGCCAGCCCGTCGGTCAACCCGCTGACGGACGCCTGCATCGTCTTCGGCAACGCCTGGGCCTGCGAGGGCTAC
GACCGGCCCGGCCTCAGCGACGACTACACCGACGGCCTCATCAAGAAGGTGGCGGGCCAGTGCGCCAAGACCATC
GTCGTCTTCCACAACGCCGGCGTCCGGCTCGTCGAGGCCTTCGCCGACCACCCCAACGTCACGGCCATCATCTTC
GCCCACCTGCCGGGGCGCGACAGCGGCGAGGCCCTCGTCTCGCTGCTCTACGGCCACTCGGCGCCGTCGGGCAAG
CTGCCGTACACGGTGGCCCGGAAGGCGTCCGACTACGGCGACGGGCTGGACCCGGCCGGGCCGCGGGGCCGGTAC
GCCCGCTTCCCCCAGTCCGACTTCAGCGAGGGCACCTACCTCGACTACAAGCACCTGGACGACAGGGGCATCGAG
CCCCGGTACGAGTTCGGCTTCGGCCTGAGCTACACCACCTTCAGCCTGTCCGGGCTCTACATCCAGCCGCTGCGG
GCCTTCAACATGGGGCCCTTCCCGGTCGGGCCCGTGGTGGCCGGCGGCCCGAGCGACCTGTGGGAGCCCATGGCC
TACGTCAGCGCCACGGTCCGCAACACGGGCGCCGCGCCCGGCGCCGAGGTGGCGCAGCTGTACGTCGGCATCCCC
GGCGGGCCGCCGCGGCAGTTGCGCGGCTTCGAGAAGCGCTACCTGGTGCCGGGCCAGCAGCAGGTCGTCACCTTT
CGCCTGACGCGGCGGGACCTGAGCACGTGGGACGCGGGCGCGCAGGCCTGGCGCTTGGAGCGCGGGCCCTTTCAC
ATTTATGTCGGCAACAGCAGCCGGAACCTGCCGCTCAAGGGCATCATCCAGCTGTGA
Transcript >Hirsu2|10976
ATGTTCCAGCCTCTGCTCTCCGGCCTCGCCGTCCTGGCCGCCCTGCCGGCCGTGGCGGCGGCCGTCCAGAACGGC
AGCCGCCCGATCGGCGACGACGGCCATTTCTTCGGCCAGTCGCCGCCCGTCTACCCCTCTCCGCCCATGACGGGG
GGGGCCTGGGCCGGCGCCTACGCCCGGGCTAGGGACCTGGTCGGCCGGATGACGCTCGAGGAGAAGGTCAGCCTC
ACCGGCGGCGCCGACGTCGGCTCCGGCTGCAGCGGCTCCGTCCCGCCCATCCAGCGGCTCGGCTTCCCGGGCATG
TGCCTCACCGACAACGGCAACGGCGTGCGGAACACGGACCTGGTCAACTCGTACCCGAGCGGCATCCACGTCGGC
GCCAGCTGGAACAAGGTGCTCGCCCGCGCGCGCGGCTCCGCCATGGGCGCCGAGTTCCGGAGAAAGGGCGTCAAC
GTCATGCTCGGCCCCGTCGTCGGCCCCGCCTGGCGCGTTCCCCGCAGCGGCCGCAACTGGGAGGGCTTCTCCGTC
GACCCCTACCTGGCCGGCTCGCTCGTCGCCGAGAGCGTCCTGGCCACCCAGGCCGAGGGCGTCCAGACGAGCGTC
AAGCACTACATCGCCAACGAGCAAGAGTCGTACCGCACGCCCGTCGGCCTCACCGAGGCCGTCTCCTCCAACATT
GACGACAGGACCATGCACGAGGTCTATCTCTGGCCCTTTCAGGATGCGGTCAGAGCCGGGGCCGCCAACATCATG
TGCTCGTACCAGCGCATCAACAACTCGTACGGCTGCGCCAACAGCAAGACGCTCAACGGCCTGCTCAAGACCGAG
CTCGGCTTTCAGGGCTTCGTCGTGTCCGATTGGGGCGCCCAGCACACCGGCGTCGCCAGCGCTCTGGCCGGCATG
GACATGGCCATGCCCAGCGGGAACGGCTACTGGGGCGAGAAGCTCGTCGAGGCGGTCAAGAACGGCTCGGTGCCG
GAATCGCGCGTCGACGACATGGCGACGAGGATCATCACGACCTGGTACCAGTTCCGCCAAGACACCCTCTTCCCC
CGCCCGGGCATCGGCATGCCCAAGGCCCTGACGGAGCCGCACGCAGCCGTGGACGGGCGCGACGCCGGCGCCCTG
CCCATCATCTACCAGGGCGCCCTGGAGGGCCACGTGCTCGTCAAGAACACCAAGGCGACGCTCCCGCTGCGCCGG
CCGCGCATGCTGTCCCTGTTCGGCTACTCGGCCAAGTCGCCCGACACGTCCAACCCCAGCTCCGCCGTGCTGGAC
AGCCTGGCCTGGGCCGTCGGCGCGCAGACGATCGCCAGGGACGAGTTCTTGGCCGGCCTCGCCCCCTTCAGCCCC
AACACGAGCTACCCTGCCATCGGCAAGCGGGGCGCGCTCATCACCGGCTGCGGCTCCGGCGCCACCACCGCGGCC
GTCTTCACCGCGCCCTTCGAGTCGCTCAAGCTCCGGGCCGCGCGCGAGGACACGGCCCTCTTCTACGACTTCGAC
TCGGCCAGCCCGTCGGTCAACCCGCTGACGGACGCCTGCATCGTCTTCGGCAACGCCTGGGCCTGCGAGGGCTAC
GACCGGCCCGGCCTCAGCGACGACTACACCGACGGCCTCATCAAGAAGGTGGCGGGCCAGTGCGCCAAGACCATC
GTCGTCTTCCACAACGCCGGCGTCCGGCTCGTCGAGGCCTTCGCCGACCACCCCAACGTCACGGCCATCATCTTC
GCCCACCTGCCGGGGCGCGACAGCGGCGAGGCCCTCGTCTCGCTGCTCTACGGCCACTCGGCGCCGTCGGGCAAG
CTGCCGTACACGGTGGCCCGGAAGGCGTCCGACTACGGCGACGGGCTGGACCCGGCCGGGCCGCGGGGCCGGTAC
GCCCGCTTCCCCCAGTCCGACTTCAGCGAGGGCACCTACCTCGACTACAAGCACCTGGACGACAGGGGCATCGAG
CCCCGGTACGAGTTCGGCTTCGGCCTGAGCTACACCACCTTCAGCCTGTCCGGGCTCTACATCCAGCCGCTGCGG
GCCTTCAACATGGGGCCCTTCCCGGTCGGGCCCGTGGTGGCCGGCGGCCCGAGCGACCTGTGGGAGCCCATGGCC
TACGTCAGCGCCACGGTCCGCAACACGGGCGCCGCGCCCGGCGCCGAGGTGGCGCAGCTGTACGTCGGCATCCCC
GGCGGGCCGCCGCGGCAGTTGCGCGGCTTCGAGAAGCGCTACCTGGTGCCGGGCCAGCAGCAGGTCGTCACCTTT
CGCCTGACGCGGCGGGACCTGAGCACGTGGGACGCGGGCGCGCAGGCCTGGCGCTTGGAGCGCGGGCCCTTTCAC
ATTTATGTCGGCAACAGCAGCCGGAACCTGCCGCTCAAGGGCATCATCCAGCTGTGA
Gene >Hirsu2|10976
ATGTTCCAGCCTCTGCTCTCCGGCCTCGCCGTCCTGGCCGCCCTGCCGGCCGTGGCGGCGGCCGTCCAGAACGGC
AGCCGCCCGATCGGCGACGACGGCCATTTCTTCGGCCAGTCGCCGCCCGTCTACCCCTCTCGTGAGTCGGTCGCC
AGGCCGATGCGGAACTGACTGACGCGCGCGTGCGCAGCGCCCATGACGGGGGGGGCCTGGGCCGGCGCCTACGCC
CGGGCTAGGGACCTGGTCGGCCGGATGACGCTCGAGGAGAAGGTCGGTTGGCTAGCCCACGTTTCCGTCCGCTTG
CCCGTCCATTGACGCCGCCCCCCCGCCCCCCGCAGGTCAGCCTCACCGGCGGCGCCGACGTCGGCTCCGGCTGCA
GCGGCTCCGTCCCGCCCATCCAGCGGCTCGGCTTCCCGGGCATGTGCCTCACCGACAACGGCAACGGCGTGCGGA
ACACGGACCTGGTCAACTCGTACCCGAGCGGCATCCACGTCGGCGCCAGGTGAGCCCGCTTACCTTTTGGTCCGA
TTGATTTTGCCTTGCCCCGCCGCTCAACGACCCGTCGGCAGCTGGAACAAGGTGCTCGCCCGCGCGCGCGGCTCC
GCCATGGGCGCCGAGTTCCGGAGAAAGGGCGTCAACGTCATGCTCGGCCCCGTCGTCGGCCCCGCCTGGCGCGTT
CCCCGCAGCGGCCGCAACTGGGAGGGCTTCTCCGTCGACCCCTACCTGGCCGGCTCGCTCGTCGCCGAGAGCGTC
CTGGCCACCCAGGCCGAGGGCGTCCAGACGAGCGTCAAGGTTGTTGGCCTCAGTTTCCGTCGACGGCGCGAGCTA
ATGCGCCCGCTCGCCAGCACTACATCGCCAACGAGCAAGAGTCGTACCGCACGCCCGTCGGCCTCACCGAGGCCG
TCTCCTCCAACATTGACGACAGGACCATGCACGAGGTCTATCTCTGGTAGGGACGAGCCGCCTCTCGCGACAACA
ATCTGCCTCGGCTGACCTCGCCCGCGCCGCCCAGGCCCTTTCAGGATGCGGTCAGAGCCGGGGCCGCCAACATCA
TGTGCTCGTACCAGCGCATCAACAACTCGTACGGCTGCGCCAACAGCAAGACGCTCAACGGCCTGCTCAAGACCG
AGCTCGGCTTTCAGGTGCGTGGCTGTCCGTCGCATCCCCGAGACATCCGCCCGCTGATCGCCGTCGTCGCCAGGG
CTTCGTCGTGTCCGATTGGGGCGCCCAGCACACCGGCGTCGCCAGCGCTCTGGCCGGCATGGACATGGCCATGCC
CAGCGGGAACGGCTACTGGGGCGAGAAGCTCGTCGAGGCGGTCAAGAACGGCTCGGTGCCGGAATCGCGCGTCGA
CGACATGGCGACGAGGATCATCACGACCTGGTACCAGTTCCGCCAAGACACCCTCTTCCCCCGCCCGGGCATCGG
CATGCCCAAGGCCCTGACGGAGCCGCACGCAGCCGTGGACGGGCGCGACGCCGGCGCCCTGCCCATCATCTACCA
GGGCGCCCTGGAGGGCCACGTGCTCGTCAAGAACACCAAGGCGACGCTCCCGCTGCGCCGGCCGCGCATGCTGTC
CCTGTTCGGCTACTCGGCCAAGTCGCCCGACACGTCCAACCCCAGCTCCGCCGTGCTGGACAGCCTGGCCTGGGC
CGTCGGCGCGCAGACGATCGCCAGGGACGAGTTCTTGGCCGGCCTCGCCCCCTTCAGCCCCAACACGAGCTACCC
TGCCATCGGCAAGCGGGGCGCGCTCATCACCGGCTGCGGCTCCGGCGCCACCACCGCGGCCGTCTTCACCGCGCC
CTTCGAGTCGCTCAAGCTCCGGGCCGCGCGCGAGGACACGGCCCTCTTCTACGACTTCGACTCGGCCAGCCCGTC
GGTCAACCCGCTGACGGACGCCTGCATCGTCTTCGGCAACGCCTGGGCCTGCGAGGGCTACGACCGGCCCGGCCT
CAGCGACGACTACACCGACGGCCTCATCAAGAAGGTGGCGGGCCAGTGCGCCAAGACCATCGTCGTCTTCCACAA
CGCCGGCGTCCGGCTCGTCGAGGCCTTCGCCGACCACCCCAACGTCACGGCCATCATCTTCGCCCACCTGCCGGG
GCGCGACAGCGGCGAGGCCCTCGTCTCGCTGCTCTACGGCCACTCGGCGCCGTCGGGCAAGCTGCCGTACACGGT
GGCCCGGAAGGCGTCCGACTACGGCGACGGGCTGGACCCGGCCGGGCCGCGGGGCCGGTACGCCCGCTTCCCCCA
GTCCGACTTCAGCGAGGGCACCTACCTCGACTACAAGCACCTGGACGACAGGGGCATCGAGCCCCGGTACGAGTT
CGGCTTCGGCCTGAGCTACACCACCTTCAGCCTGTCCGGGCTCTACATCCAGCCGCTGCGGGCCTTCAACATGGG
GCCCTTCCCGGTCGGGCCCGTGGTGGCCGGCGGCCCGAGCGACCTGTGGGAGCCCATGGCCTACGTCAGCGCCAC
GGTCCGCAACACGGGCGCCGCGCCCGGCGCCGAGGTGGCGCAGCTGTACGTCGGCATCCCCGGCGGGCCGCCGCG
GCAGTTGCGCGGCTTCGAGAAGCGCTACCTGGTGCCGGGCCAGCAGCAGGTCGTCACCTTTCGCCTGACGCGGCG
GGACCTGAGCACGTGGGACGCGGGCGCGCAGGCCTGGCGCTTGGAGCGCGGGCCCTTTCACATTTATGTCGGCAA
CAGCAGCCGGAACCTGCCGCTCAAGGGCATCATCCAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail