Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10975
Gene name
LocationContig_938:4233..5487
Strand+
Gene length (bp)1254
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 6.8E-13 8 240
PF01494 FAD_binding_3 FAD binding domain 8.4E-08 315 355

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01911|TETX_BACFG Tetracycline resistance protein from transposon Tn4351/Tn4400 OS=Bacteroides fragilis GN=tetX PE=4 SV=1 7 397 8.0E-26
sp|P0CO48|KMO_CRYNJ Kynurenine 3-monooxygenase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BNA4 PE=3 SV=1 3 350 1.0E-11
sp|P0CO49|KMO_CRYNB Kynurenine 3-monooxygenase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BNA4 PE=3 SV=1 3 350 4.0E-11
sp|Q91WN4|KMO_MOUSE Kynurenine 3-monooxygenase OS=Mus musculus GN=Kmo PE=1 SV=1 7 340 3.0E-08
sp|Q1RLY6|KMO_DANRE Kynurenine 3-monooxygenase OS=Danio rerio GN=kmo PE=2 SV=1 2 340 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01911|TETX_BACFG Tetracycline resistance protein from transposon Tn4351/Tn4400 OS=Bacteroides fragilis GN=tetX PE=4 SV=1 7 397 8.0E-26
sp|P0CO48|KMO_CRYNJ Kynurenine 3-monooxygenase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BNA4 PE=3 SV=1 3 350 1.0E-11
sp|P0CO49|KMO_CRYNB Kynurenine 3-monooxygenase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BNA4 PE=3 SV=1 3 350 4.0E-11
sp|Q91WN4|KMO_MOUSE Kynurenine 3-monooxygenase OS=Mus musculus GN=Kmo PE=1 SV=1 7 340 3.0E-08
sp|Q1RLY6|KMO_DANRE Kynurenine 3-monooxygenase OS=Danio rerio GN=kmo PE=2 SV=1 2 340 2.0E-07
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 106 397 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0050662 coenzyme binding No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10975
MSSRRPRIAIVGGGPAGLMLGLLLHRRGIPFTLFELRQRPSEEELAKPSGMLDLHDESGLAAIRECGLYDEFLKL
TGECAEAQKVADMSGKILYSDQGELSERPEISRHALTRLLCSHLPAETIRWGHKLVSVASTETSAGPGMELDFGP
LGRTTFDLVVGADGAWSQVRALLTNIRPRYSGRQNVTLTVRNITAKHPHLAELVGLGSFSALGLRHGVMSQRGPQ
DSARIYIFLTTADEDFGTTSGLAGRPAAAAAKHLLLTDDALLGRWGPPIRELVTVACDEESADNPGAAVDIKPLY
TLPVGAAWEHRANATLIGDAAHLMCPWAGEGVNLAMWDALSLAGAISRAYETAGHDTSAFQKTLDPLMREFEAEM
VARARDKAEETHSNGEMLFGDDAAQAFTQFFLRVYPADQHAT*
Coding >Hirsu2|10975
ATGAGCTCGCGCCGGCCCCGAATCGCCATCGTTGGCGGCGGTCCAGCGGGGCTGATGCTTGGCCTGCTGCTGCAC
CGGCGCGGCATTCCATTTACGCTATTCGAACTCCGCCAGCGGCCGTCCGAGGAAGAGCTCGCCAAGCCGTCGGGC
ATGCTCGATCTCCACGACGAGTCGGGCCTCGCCGCGATTCGAGAGTGCGGCCTATACGACGAGTTCCTGAAACTG
ACGGGCGAGTGCGCAGAGGCGCAAAAGGTGGCCGACATGAGCGGCAAGATCCTCTACTCGGACCAGGGGGAACTG
AGCGAGCGCCCCGAAATCTCCCGCCACGCCCTCACCAGGCTCCTGTGCTCTCACCTCCCGGCCGAGACCATCAGG
TGGGGGCACAAGCTCGTGTCTGTCGCCAGCACCGAGACATCGGCCGGCCCCGGCATGGAGCTCGACTTCGGCCCG
CTCGGCAGGACGACGTTCGACCTCGTCGTCGGCGCCGACGGCGCCTGGTCCCAGGTCCGCGCCCTGCTAACAAAC
ATACGGCCGCGCTACTCCGGGAGGCAGAACGTGACGCTGACGGTGCGCAACATCACCGCCAAGCACCCGCACCTG
GCCGAGCTCGTCGGCCTCGGCAGCTTCTCCGCCCTCGGCCTCCGGCACGGCGTCATGTCCCAGCGCGGGCCGCAG
GACTCGGCCCGCATCTACATCTTCCTGACGACGGCCGACGAGGACTTCGGCACCACGTCCGGGCTGGCGGGACGG
CCCGCCGCCGCCGCCGCCAAGCACCTGCTCCTCACCGATGACGCCCTCCTCGGCCGCTGGGGCCCGCCCATCCGC
GAGCTCGTGACGGTCGCGTGCGACGAGGAGTCGGCCGACAACCCGGGTGCCGCCGTCGACATCAAGCCACTATAC
ACGCTGCCCGTCGGCGCGGCCTGGGAGCATAGGGCGAACGCGACGCTCATCGGCGATGCGGCGCACTTGATGTGT
CCGTGGGCTGGCGAGGGGGTCAATCTGGCCATGTGGGACGCGCTGTCTCTGGCCGGTGCAATATCGCGGGCGTAC
GAAACGGCAGGACACGACACGTCTGCTTTCCAGAAGACGCTCGATCCTCTGATGAGGGAGTTCGAGGCAGAGATG
GTGGCGCGGGCGAGGGACAAGGCGGAAGAGACGCACAGCAACGGAGAGATGCTGTTCGGCGACGACGCTGCCCAG
GCTTTTACGCAGTTCTTCCTCCGCGTGTACCCTGCTGATCAGCACGCGACTTAA
Transcript >Hirsu2|10975
ATGAGCTCGCGCCGGCCCCGAATCGCCATCGTTGGCGGCGGTCCAGCGGGGCTGATGCTTGGCCTGCTGCTGCAC
CGGCGCGGCATTCCATTTACGCTATTCGAACTCCGCCAGCGGCCGTCCGAGGAAGAGCTCGCCAAGCCGTCGGGC
ATGCTCGATCTCCACGACGAGTCGGGCCTCGCCGCGATTCGAGAGTGCGGCCTATACGACGAGTTCCTGAAACTG
ACGGGCGAGTGCGCAGAGGCGCAAAAGGTGGCCGACATGAGCGGCAAGATCCTCTACTCGGACCAGGGGGAACTG
AGCGAGCGCCCCGAAATCTCCCGCCACGCCCTCACCAGGCTCCTGTGCTCTCACCTCCCGGCCGAGACCATCAGG
TGGGGGCACAAGCTCGTGTCTGTCGCCAGCACCGAGACATCGGCCGGCCCCGGCATGGAGCTCGACTTCGGCCCG
CTCGGCAGGACGACGTTCGACCTCGTCGTCGGCGCCGACGGCGCCTGGTCCCAGGTCCGCGCCCTGCTAACAAAC
ATACGGCCGCGCTACTCCGGGAGGCAGAACGTGACGCTGACGGTGCGCAACATCACCGCCAAGCACCCGCACCTG
GCCGAGCTCGTCGGCCTCGGCAGCTTCTCCGCCCTCGGCCTCCGGCACGGCGTCATGTCCCAGCGCGGGCCGCAG
GACTCGGCCCGCATCTACATCTTCCTGACGACGGCCGACGAGGACTTCGGCACCACGTCCGGGCTGGCGGGACGG
CCCGCCGCCGCCGCCGCCAAGCACCTGCTCCTCACCGATGACGCCCTCCTCGGCCGCTGGGGCCCGCCCATCCGC
GAGCTCGTGACGGTCGCGTGCGACGAGGAGTCGGCCGACAACCCGGGTGCCGCCGTCGACATCAAGCCACTATAC
ACGCTGCCCGTCGGCGCGGCCTGGGAGCATAGGGCGAACGCGACGCTCATCGGCGATGCGGCGCACTTGATGTGT
CCGTGGGCTGGCGAGGGGGTCAATCTGGCCATGTGGGACGCGCTGTCTCTGGCCGGTGCAATATCGCGGGCGTAC
GAAACGGCAGGACACGACACGTCTGCTTTCCAGAAGACGCTCGATCCTCTGATGAGGGAGTTCGAGGCAGAGATG
GTGGCGCGGGCGAGGGACAAGGCGGAAGAGACGCACAGCAACGGAGAGATGCTGTTCGGCGACGACGCTGCCCAG
GCTTTTACGCAGTTCTTCCTCCGCGTGTACCCTGCTGATCAGCACGCGACTTAA
Gene >Hirsu2|10975
ATGAGCTCGCGCCGGCCCCGAATCGCCATCGTTGGCGGCGGTCCAGCGGGGCTGATGCTTGGCCTGCTGCTGCAC
CGGCGCGGCATTCCATTTACGCTATTCGAACTCCGCCAGCGGCCGTCCGAGGAAGAGCTCGCCAAGCCGTCGGGC
ATGCTCGATCTCCACGACGAGTCGGGCCTCGCCGCGATTCGAGAGTGCGGCCTATACGACGAGTTCCTGAAACTG
ACGGGCGAGTGCGCAGAGGCGCAAAAGGTGGCCGACATGAGCGGCAAGATCCTCTACTCGGACCAGGGGGAACTG
AGCGAGCGCCCCGAAATCTCCCGCCACGCCCTCACCAGGCTCCTGTGCTCTCACCTCCCGGCCGAGACCATCAGG
TGGGGGCACAAGCTCGTGTCTGTCGCCAGCACCGAGACATCGGCCGGCCCCGGCATGGAGCTCGACTTCGGCCCG
CTCGGCAGGACGACGTTCGACCTCGTCGTCGGCGCCGACGGCGCCTGGTCCCAGGTCCGCGCCCTGCTAACAAAC
ATACGGCCGCGCTACTCCGGGAGGCAGAACGTGACGCTGACGGTGCGCAACATCACCGCCAAGCACCCGCACCTG
GCCGAGCTCGTCGGCCTCGGCAGCTTCTCCGCCCTCGGCCTCCGGCACGGCGTCATGTCCCAGCGCGGGCCGCAG
GACTCGGCCCGCATCTACATCTTCCTGACGACGGCCGACGAGGACTTCGGCACCACGTCCGGGCTGGCGGGACGG
CCCGCCGCCGCCGCCGCCAAGCACCTGCTCCTCACCGATGACGCCCTCCTCGGCCGCTGGGGCCCGCCCATCCGC
GAGCTCGTGACGGTCGCGTGCGACGAGGAGTCGGCCGACAACCCGGGTGCCGCCGTCGACATCAAGCCACTATAC
ACGCTGCCCGTCGGCGCGGCCTGGGAGCATAGGGCGAACGCGACGCTCATCGGCGATGCGGCGCACTTGATGTGT
CCGTGGGCTGGCGAGGGGGTCAATCTGGCCATGTGGGACGCGCTGTCTCTGGCCGGTGCAATATCGCGGGCGTAC
GAAACGGCAGGACACGACACGTCTGCTTTCCAGAAGACGCTCGATCCTCTGATGAGGGAGTTCGAGGCAGAGATG
GTGGCGCGGGCGAGGGACAAGGCGGAAGAGACGCACAGCAACGGAGAGATGCTGTTCGGCGACGACGCTGCCCAG
GCTTTTACGCAGTTCTTCCTCCGCGTGTACCCTGCTGATCAGCACGCGACTTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail