Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10972
Gene name
LocationContig_937:6183..7722
Strand+
Gene length (bp)1539
Transcript length (bp)1539
Coding sequence length (bp)1539
Protein length (aa) 513

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.7E-17 107 301
PF07690 MFS_1 Major Facilitator Superfamily 3.1E-10 290 457
PF01306 LacY_symp LacY proton/sugar symporter 1.1E-07 120 264

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 41 500 3.0E-74
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 28 501 4.0E-68
sp|Q3U9N9|MOT10_MOUSE Monocarboxylate transporter 10 OS=Mus musculus GN=Slc16a10 PE=1 SV=1 1 455 2.0E-27
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 73 480 2.0E-26
sp|Q8BGC3|MOT12_MOUSE Monocarboxylate transporter 12 OS=Mus musculus GN=Slc16a12 PE=2 SV=1 73 500 7.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 41 500 3.0E-74
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 28 501 4.0E-68
sp|Q3U9N9|MOT10_MOUSE Monocarboxylate transporter 10 OS=Mus musculus GN=Slc16a10 PE=1 SV=1 1 455 2.0E-27
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 73 480 2.0E-26
sp|Q8BGC3|MOT12_MOUSE Monocarboxylate transporter 12 OS=Mus musculus GN=Slc16a12 PE=2 SV=1 73 500 7.0E-26
sp|Q91Y77|MOT10_RAT Monocarboxylate transporter 10 OS=Rattus norvegicus GN=Slc16a10 PE=1 SV=1 5 455 1.0E-25
sp|Q503M4|MT12B_DANRE Monocarboxylate transporter 12-B OS=Danio rerio GN=slc16a12b PE=2 SV=1 57 488 1.0E-23
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 73 457 2.0E-23
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 73 436 2.0E-23
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 73 454 2.0E-23
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 73 487 3.0E-23
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 73 457 1.0E-22
sp|P57787|MOT4_MOUSE Monocarboxylate transporter 4 OS=Mus musculus GN=Slc16a3 PE=1 SV=1 62 511 1.0E-22
sp|O60669|MOT2_HUMAN Monocarboxylate transporter 2 OS=Homo sapiens GN=SLC16A7 PE=1 SV=2 75 491 2.0E-22
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 73 454 3.0E-22
sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus GN=Slc16a7 PE=1 SV=1 71 436 4.0E-22
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 73 454 4.0E-22
sp|O35910|MOT4_RAT Monocarboxylate transporter 4 OS=Rattus norvegicus GN=Slc16a3 PE=1 SV=1 62 436 7.0E-22
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 73 489 1.0E-21
sp|O15427|MOT4_HUMAN Monocarboxylate transporter 4 OS=Homo sapiens GN=SLC16A3 PE=1 SV=1 62 455 3.0E-21
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 65 486 3.0E-21
sp|Q5ZJU0|MOT9_CHICK Monocarboxylate transporter 9 OS=Gallus gallus GN=SLC16A9 PE=2 SV=1 73 260 2.0E-20
sp|Q6P2X9|MOT12_XENTR Monocarboxylate transporter 12 OS=Xenopus tropicalis GN=slc16a12 PE=2 SV=1 73 457 2.0E-20
sp|Q8TF71|MOT10_HUMAN Monocarboxylate transporter 10 OS=Homo sapiens GN=SLC16A10 PE=1 SV=1 76 436 2.0E-20
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 74 365 5.0E-20
sp|O70461|MOT3_RAT Monocarboxylate transporter 3 OS=Rattus norvegicus GN=Slc16a8 PE=2 SV=1 75 436 6.0E-20
sp|O35308|MOT3_MOUSE Monocarboxylate transporter 3 OS=Mus musculus GN=Slc16a8 PE=2 SV=2 75 436 6.0E-20
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 73 454 6.0E-20
sp|Q7RTY1|MOT9_HUMAN Monocarboxylate transporter 9 OS=Homo sapiens GN=SLC16A9 PE=1 SV=1 74 251 1.0E-19
sp|B1AT66|MOT7_MOUSE Monocarboxylate transporter 7 OS=Mus musculus GN=Slc16a6 PE=1 SV=1 74 260 4.0E-19
sp|Q5R5M4|MOT9_PONAB Monocarboxylate transporter 9 OS=Pongo abelii GN=SLC16A9 PE=2 SV=1 74 251 2.0E-18
sp|Q63344|MOT2_RAT Monocarboxylate transporter 2 OS=Rattus norvegicus GN=Slc16a7 PE=1 SV=1 75 455 2.0E-18
sp|Q90632|MOT3_CHICK Monocarboxylate transporter 3 OS=Gallus gallus GN=SLC16A3 PE=2 SV=2 69 454 3.0E-18
sp|Q7TM99|MOT9_MOUSE Monocarboxylate transporter 9 OS=Mus musculus GN=Slc16a9 PE=2 SV=1 74 251 8.0E-18
sp|P53988|MOT2_MESAU Monocarboxylate transporter 2 OS=Mesocricetus auratus GN=SLC16A7 PE=1 SV=1 75 454 1.0E-17
sp|O95907|MOT3_HUMAN Monocarboxylate transporter 3 OS=Homo sapiens GN=SLC16A8 PE=2 SV=1 73 217 1.0E-17
sp|O15403|MOT7_HUMAN Monocarboxylate transporter 7 OS=Homo sapiens GN=SLC16A6 PE=1 SV=2 74 254 2.0E-17
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 1 463 1.0E-16
sp|Q3MHW6|MOT1_BOVIN Monocarboxylate transporter 1 OS=Bos taurus GN=SLC16A1 PE=2 SV=2 73 505 2.0E-16
sp|G5E8K6|MOT6_MOUSE Monocarboxylate transporter 6 OS=Mus musculus GN=Slc16a5 PE=3 SV=1 75 489 4.0E-14
sp|P53986|MOT1_MOUSE Monocarboxylate transporter 1 OS=Mus musculus GN=Slc16a1 PE=1 SV=1 73 217 1.0E-13
sp|Q03064|MOT1_CRILO Monocarboxylate transporter 1 OS=Cricetulus longicaudatus GN=SLC16A1 PE=1 SV=1 73 217 1.0E-13
sp|Q7RTX9|MOT14_HUMAN Monocarboxylate transporter 14 OS=Homo sapiens GN=SLC16A14 PE=2 SV=1 70 260 2.0E-13
sp|P53987|MOT1_RAT Monocarboxylate transporter 1 OS=Rattus norvegicus GN=Slc16a1 PE=1 SV=1 73 503 2.0E-13
sp|O15375|MOT6_HUMAN Monocarboxylate transporter 6 OS=Homo sapiens GN=SLC16A5 PE=2 SV=1 75 452 3.0E-13
sp|Q8K1C7|MOT14_MOUSE Monocarboxylate transporter 14 OS=Mus musculus GN=Slc16a14 PE=2 SV=1 70 260 9.0E-13
sp|Q8NCK7|MOT11_HUMAN Monocarboxylate transporter 11 OS=Homo sapiens GN=SLC16A11 PE=2 SV=1 70 457 1.0E-12
sp|Q8R0M8|MOT5_MOUSE Monocarboxylate transporter 5 OS=Mus musculus GN=Slc16a4 PE=2 SV=1 66 259 2.0E-12
sp|P53985|MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens GN=SLC16A1 PE=1 SV=3 73 217 9.0E-12
sp|O15374|MOT5_HUMAN Monocarboxylate transporter 5 OS=Homo sapiens GN=SLC16A4 PE=2 SV=1 75 259 1.0E-10
sp|Q5NC32|MOT11_MOUSE Monocarboxylate transporter 11 OS=Mus musculus GN=Slc16a11 PE=2 SV=1 70 258 1.0E-09
sp|P37662|YHJX_ECOLI Uncharacterized MFS-type transporter YhjX OS=Escherichia coli (strain K12) GN=yhjX PE=1 SV=1 117 413 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008643 carbohydrate transport Yes
GO:0016020 membrane Yes
GO:0005351 carbohydrate:proton symporter activity Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0015294 solute:cation symporter activity No
GO:0015078 proton transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0015144 carbohydrate transmembrane transporter activity No
GO:0071702 organic substance transport No
GO:0022804 active transmembrane transporter activity No
GO:0005402 carbohydrate:cation symporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0009987 cellular process No
GO:0015293 symporter activity No
GO:0015291 secondary active transmembrane transporter activity No
GO:0015295 solute:proton symporter activity No
GO:0005215 transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0022853 active ion transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 121 143 22
2 150 172 22
3 176 198 22
4 210 232 22
5 237 259 22
6 283 305 22
7 320 339 19
8 346 365 19
9 369 391 22
10 404 426 22
11 441 460 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10972
MTPGREPTAEDASGRARVPPEPLSDAADDGPGRHAVAPTGEEHKATRQQPLEPFSENEGGRGGSLDDGAPPPPPD
GGYGWVCTACVGIVNAHCWGLNSSYGVFLAHYLANDTFPGASSLEYAFVGSLSISCALLVSPIATICVRELGTKP
TMLCGAVMEAVSLICASLARSIWHLFLTQGLLFGIGMGFLFIPSVGIVSQWFSTRRSLANGISACGSGLGGLVYS
FAAGAMIRDLGIQWTFRILGIIALVVNVVCTLLLKDRNKIIGSSQLAFDTSLFRRPEFLVLIAFGWFSMLAYVVL
IFSLASYANRIGLGPSQAALVSAFFNLGQAIGRPFVGYFSDRTGRINMSALTTLLAAVFSLAIWINARVYGVLIF
FALVCGCVAGTFWATISPVTAEVVGLRHVPSALSLIWLSIMLPCLFSEPIALQIVAGTGSYLGTQLFVGMMFVAA
ALCLVALRGWKIGQVREMARLADEAPEQLDPVKLENNEEFSGRARKVGRKTMAADCWKRSKV*
Coding >Hirsu2|10972
ATGACGCCGGGCCGTGAACCCACAGCGGAAGACGCCAGCGGCCGGGCCCGAGTTCCACCAGAGCCCCTCTCGGAC
GCCGCCGACGACGGGCCCGGCCGCCATGCCGTCGCCCCGACCGGCGAGGAGCACAAGGCCACCCGACAGCAGCCG
CTTGAGCCTTTCTCCGAGAATGAGGGGGGCCGCGGCGGATCCTTGGACGACGGCGCGCCGCCTCCGCCGCCCGAT
GGCGGTTACGGCTGGGTCTGCACCGCCTGCGTGGGCATCGTCAACGCCCACTGCTGGGGCCTCAACTCCAGCTAC
GGCGTCTTCCTGGCCCACTACCTGGCCAACGACACCTTCCCGGGGGCCTCGTCTCTCGAGTATGCCTTCGTCGGC
TCTCTCAGCATCAGCTGCGCCCTTCTCGTGTCCCCCATCGCCACCATCTGCGTGCGCGAGCTGGGCACCAAGCCG
ACCATGCTGTGTGGCGCCGTCATGGAGGCGGTCAGCCTGATCTGTGCCAGCCTGGCCCGGAGCATCTGGCACCTC
TTCCTCACTCAGGGCCTCCTCTTCGGCATCGGCATGGGCTTCCTCTTCATCCCCTCCGTCGGCATCGTATCGCAG
TGGTTCAGCACCCGCCGCTCTCTCGCCAACGGCATCTCGGCCTGCGGGTCCGGTCTCGGCGGCCTCGTCTACTCT
TTCGCCGCCGGTGCCATGATCCGGGACCTCGGCATCCAGTGGACCTTTCGCATCCTCGGCATCATCGCTCTCGTC
GTCAACGTCGTCTGCACCCTGCTGCTCAAGGATCGCAACAAGATCATCGGCTCCAGCCAGCTCGCGTTCGACACC
TCCCTCTTCCGCCGCCCCGAATTCCTCGTGCTGATTGCGTTCGGCTGGTTCAGCATGTTGGCCTACGTCGTCCTC
ATCTTCAGCCTGGCCAGCTACGCCAACCGCATCGGGCTGGGTCCGTCGCAGGCCGCGCTCGTCAGCGCCTTCTTC
AACCTCGGCCAGGCCATCGGCAGACCCTTCGTTGGCTATTTCAGTGACCGGACAGGCCGCATCAACATGTCTGCC
CTGACCACCTTGCTCGCCGCCGTCTTCTCGCTCGCCATCTGGATCAACGCCAGGGTCTACGGCGTGCTCATCTTC
TTCGCCCTCGTCTGCGGCTGTGTCGCCGGCACCTTTTGGGCCACCATCAGCCCCGTCACTGCCGAGGTTGTCGGG
CTGAGGCACGTGCCGTCGGCGCTCAGTCTCATCTGGCTCTCCATTATGCTGCCCTGTCTATTCAGCGAGCCCATC
GCCCTGCAGATCGTCGCCGGCACAGGGAGCTACCTCGGCACCCAGCTCTTCGTCGGCATGATGTTCGTGGCCGCC
GCCCTCTGTCTCGTCGCCCTGCGTGGATGGAAGATTGGTCAGGTGCGCGAGATGGCGCGACTGGCCGACGAGGCT
CCCGAACAGCTCGACCCTGTCAAGCTGGAGAACAACGAGGAATTCAGCGGGAGAGCCCGTAAGGTGGGACGAAAG
ACGATGGCCGCCGACTGCTGGAAGAGGAGCAAAGTATAG
Transcript >Hirsu2|10972
ATGACGCCGGGCCGTGAACCCACAGCGGAAGACGCCAGCGGCCGGGCCCGAGTTCCACCAGAGCCCCTCTCGGAC
GCCGCCGACGACGGGCCCGGCCGCCATGCCGTCGCCCCGACCGGCGAGGAGCACAAGGCCACCCGACAGCAGCCG
CTTGAGCCTTTCTCCGAGAATGAGGGGGGCCGCGGCGGATCCTTGGACGACGGCGCGCCGCCTCCGCCGCCCGAT
GGCGGTTACGGCTGGGTCTGCACCGCCTGCGTGGGCATCGTCAACGCCCACTGCTGGGGCCTCAACTCCAGCTAC
GGCGTCTTCCTGGCCCACTACCTGGCCAACGACACCTTCCCGGGGGCCTCGTCTCTCGAGTATGCCTTCGTCGGC
TCTCTCAGCATCAGCTGCGCCCTTCTCGTGTCCCCCATCGCCACCATCTGCGTGCGCGAGCTGGGCACCAAGCCG
ACCATGCTGTGTGGCGCCGTCATGGAGGCGGTCAGCCTGATCTGTGCCAGCCTGGCCCGGAGCATCTGGCACCTC
TTCCTCACTCAGGGCCTCCTCTTCGGCATCGGCATGGGCTTCCTCTTCATCCCCTCCGTCGGCATCGTATCGCAG
TGGTTCAGCACCCGCCGCTCTCTCGCCAACGGCATCTCGGCCTGCGGGTCCGGTCTCGGCGGCCTCGTCTACTCT
TTCGCCGCCGGTGCCATGATCCGGGACCTCGGCATCCAGTGGACCTTTCGCATCCTCGGCATCATCGCTCTCGTC
GTCAACGTCGTCTGCACCCTGCTGCTCAAGGATCGCAACAAGATCATCGGCTCCAGCCAGCTCGCGTTCGACACC
TCCCTCTTCCGCCGCCCCGAATTCCTCGTGCTGATTGCGTTCGGCTGGTTCAGCATGTTGGCCTACGTCGTCCTC
ATCTTCAGCCTGGCCAGCTACGCCAACCGCATCGGGCTGGGTCCGTCGCAGGCCGCGCTCGTCAGCGCCTTCTTC
AACCTCGGCCAGGCCATCGGCAGACCCTTCGTTGGCTATTTCAGTGACCGGACAGGCCGCATCAACATGTCTGCC
CTGACCACCTTGCTCGCCGCCGTCTTCTCGCTCGCCATCTGGATCAACGCCAGGGTCTACGGCGTGCTCATCTTC
TTCGCCCTCGTCTGCGGCTGTGTCGCCGGCACCTTTTGGGCCACCATCAGCCCCGTCACTGCCGAGGTTGTCGGG
CTGAGGCACGTGCCGTCGGCGCTCAGTCTCATCTGGCTCTCCATTATGCTGCCCTGTCTATTCAGCGAGCCCATC
GCCCTGCAGATCGTCGCCGGCACAGGGAGCTACCTCGGCACCCAGCTCTTCGTCGGCATGATGTTCGTGGCCGCC
GCCCTCTGTCTCGTCGCCCTGCGTGGATGGAAGATTGGTCAGGTGCGCGAGATGGCGCGACTGGCCGACGAGGCT
CCCGAACAGCTCGACCCTGTCAAGCTGGAGAACAACGAGGAATTCAGCGGGAGAGCCCGTAAGGTGGGACGAAAG
ACGATGGCCGCCGACTGCTGGAAGAGGAGCAAAGTATAG
Gene >Hirsu2|10972
ATGACGCCGGGCCGTGAACCCACAGCGGAAGACGCCAGCGGCCGGGCCCGAGTTCCACCAGAGCCCCTCTCGGAC
GCCGCCGACGACGGGCCCGGCCGCCATGCCGTCGCCCCGACCGGCGAGGAGCACAAGGCCACCCGACAGCAGCCG
CTTGAGCCTTTCTCCGAGAATGAGGGGGGCCGCGGCGGATCCTTGGACGACGGCGCGCCGCCTCCGCCGCCCGAT
GGCGGTTACGGCTGGGTCTGCACCGCCTGCGTGGGCATCGTCAACGCCCACTGCTGGGGCCTCAACTCCAGCTAC
GGCGTCTTCCTGGCCCACTACCTGGCCAACGACACCTTCCCGGGGGCCTCGTCTCTCGAGTATGCCTTCGTCGGC
TCTCTCAGCATCAGCTGCGCCCTTCTCGTGTCCCCCATCGCCACCATCTGCGTGCGCGAGCTGGGCACCAAGCCG
ACCATGCTGTGTGGCGCCGTCATGGAGGCGGTCAGCCTGATCTGTGCCAGCCTGGCCCGGAGCATCTGGCACCTC
TTCCTCACTCAGGGCCTCCTCTTCGGCATCGGCATGGGCTTCCTCTTCATCCCCTCCGTCGGCATCGTATCGCAG
TGGTTCAGCACCCGCCGCTCTCTCGCCAACGGCATCTCGGCCTGCGGGTCCGGTCTCGGCGGCCTCGTCTACTCT
TTCGCCGCCGGTGCCATGATCCGGGACCTCGGCATCCAGTGGACCTTTCGCATCCTCGGCATCATCGCTCTCGTC
GTCAACGTCGTCTGCACCCTGCTGCTCAAGGATCGCAACAAGATCATCGGCTCCAGCCAGCTCGCGTTCGACACC
TCCCTCTTCCGCCGCCCCGAATTCCTCGTGCTGATTGCGTTCGGCTGGTTCAGCATGTTGGCCTACGTCGTCCTC
ATCTTCAGCCTGGCCAGCTACGCCAACCGCATCGGGCTGGGTCCGTCGCAGGCCGCGCTCGTCAGCGCCTTCTTC
AACCTCGGCCAGGCCATCGGCAGACCCTTCGTTGGCTATTTCAGTGACCGGACAGGCCGCATCAACATGTCTGCC
CTGACCACCTTGCTCGCCGCCGTCTTCTCGCTCGCCATCTGGATCAACGCCAGGGTCTACGGCGTGCTCATCTTC
TTCGCCCTCGTCTGCGGCTGTGTCGCCGGCACCTTTTGGGCCACCATCAGCCCCGTCACTGCCGAGGTTGTCGGG
CTGAGGCACGTGCCGTCGGCGCTCAGTCTCATCTGGCTCTCCATTATGCTGCCCTGTCTATTCAGCGAGCCCATC
GCCCTGCAGATCGTCGCCGGCACAGGGAGCTACCTCGGCACCCAGCTCTTCGTCGGCATGATGTTCGTGGCCGCC
GCCCTCTGTCTCGTCGCCCTGCGTGGATGGAAGATTGGTCAGGTGCGCGAGATGGCGCGACTGGCCGACGAGGCT
CCCGAACAGCTCGACCCTGTCAAGCTGGAGAACAACGAGGAATTCAGCGGGAGAGCCCGTAAGGTGGGACGAAAG
ACGATGGCCGCCGACTGCTGGAAGAGGAGCAAAGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail