Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10969
Gene name
LocationContig_936:5072..8975
Strand-
Gene length (bp)3903
Transcript length (bp)3513
Coding sequence length (bp)3513
Protein length (aa) 1171

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00982 Glyco_transf_20 Glycosyltransferase family 20 5.5E-144 464 847
PF02358 Trehalose_PPase Trehalose-phosphatase 1.9E-67 881 1127

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P31688|TPS2_YEAST Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPS2 PE=1 SV=3 312 1170 0.0E+00
sp|P78875|TPP1_SCHPO Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tpp1 PE=1 SV=2 306 1139 0.0E+00
sp|O14145|TPS2_SCHPO Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tps2 PE=3 SV=1 470 1135 3.0E-160
sp|Q54NU9|TPSB_DICDI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum GN=tpsB PE=3 SV=1 467 1104 1.0E-151
sp|Q54K57|TPSA_DICDI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum GN=tpsA PE=2 SV=1 441 1131 7.0E-138
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P31688|TPS2_YEAST Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPS2 PE=1 SV=3 312 1170 0.0E+00
sp|P78875|TPP1_SCHPO Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tpp1 PE=1 SV=2 306 1139 0.0E+00
sp|O14145|TPS2_SCHPO Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tps2 PE=3 SV=1 470 1135 3.0E-160
sp|Q54NU9|TPSB_DICDI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum GN=tpsB PE=3 SV=1 467 1104 1.0E-151
sp|Q54K57|TPSA_DICDI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum GN=tpsA PE=2 SV=1 441 1131 7.0E-138
sp|Q9LMI0|TPS7_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7 OS=Arabidopsis thaliana GN=TPS7 PE=1 SV=1 470 1138 2.0E-123
sp|Q9LRA7|TPS9_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana GN=TPS9 PE=2 SV=1 470 1141 5.0E-116
sp|Q9SYM4|TPS1_ARATH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Arabidopsis thaliana GN=TPS1 PE=1 SV=1 437 1091 5.0E-114
sp|Q0WUI9|TPS8_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana GN=TPS8 PE=2 SV=1 470 1133 3.0E-113
sp|O23617|TPS5_ARATH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana GN=TPS5 PE=1 SV=2 470 1148 4.0E-110
sp|Q9FZ57|TPS2_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Arabidopsis thaliana GN=TPS2 PE=3 SV=1 437 1141 1.0E-108
sp|O80738|TPS10_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 OS=Arabidopsis thaliana GN=TPS10 PE=2 SV=1 470 1144 6.0E-108
sp|Q9ZV48|TPS11_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11 OS=Arabidopsis thaliana GN=TPS11 PE=2 SV=1 470 1141 2.0E-107
sp|Q94AH8|TPS6_ARATH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 OS=Arabidopsis thaliana GN=TPS6 PE=1 SV=2 421 1138 3.0E-107
sp|G4RK44|TPSP_THETK Bifunctional trehalose-6-phosphate synthase/phosphatase OS=Thermoproteus tenax (strain ATCC 35583 / NBRC 100435 / JCM 9277 / Kra 1) GN=tpsp PE=1 SV=1 492 1091 5.0E-104
sp|Q9T079|TPS4_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 4 OS=Arabidopsis thaliana GN=TPS4 PE=3 SV=1 441 1139 6.0E-102
sp|Q9SHG0|TPS3_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 3 OS=Arabidopsis thaliana GN=TPS3 PE=3 SV=3 437 1091 1.0E-99
sp|P40387|TPS1_SCHPO Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tps1 PE=1 SV=2 421 848 2.0E-97
sp|O14081|TPSX_SCHPO Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E11.16c PE=1 SV=1 383 1091 5.0E-97
sp|O74932|TPS1_YARLI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TPS1 PE=2 SV=1 418 839 3.0E-96
sp|Q07158|TPS1_KLULA Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPS1 PE=3 SV=1 418 839 8.0E-93
sp|Q00764|TPS1_YEAST Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPS1 PE=1 SV=2 418 839 6.0E-92
sp|Q92410|TPS1_CANAL Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPS1 PE=2 SV=1 418 848 2.0E-89
sp|Q9UUI7|TPSY_SCHPO Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22F8.05 PE=1 SV=1 464 1114 2.0E-88
sp|O94213|TPS1_PICAN Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Pichia angusta GN=TPS1 PE=3 SV=1 443 850 1.0E-87
sp|Q00075|TPSA_ASPNG Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Aspergillus niger GN=tpsA PE=3 SV=1 418 839 4.0E-87
sp|O59921|TPS1_EMENI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpsA PE=3 SV=1 418 853 2.0E-85
sp|Q96WK6|TPS1_ZYGRO Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Zygosaccharomyces rouxii GN=TPS1 PE=2 SV=1 440 839 3.0E-83
sp|P38427|TSL1_YEAST Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSL1 PE=1 SV=1 464 1006 1.0E-82
sp|Q00217|TPSB_ASPNG Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Aspergillus niger GN=tpsB PE=3 SV=1 418 839 1.0E-82
sp|P38426|TPS3_YEAST Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPS3 PE=1 SV=3 467 1006 1.0E-81
sp|A0R4M9|OTSA_MYCS2 Trehalose-phosphate synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=otsA PE=1 SV=1 493 855 3.0E-56
sp|Q8SSL2|TPS1_ENCCU Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Encephalitozoon cuniculi (strain GB-M1) GN=TPS1 PE=1 SV=1 499 820 1.0E-53
sp|P74258|GGPS_SYNY3 Glucosylglycerol-phosphate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ggpS PE=1 SV=1 496 853 2.0E-53
sp|A7MEE9|OTSA_CROS8 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=otsA PE=3 SV=1 479 850 3.0E-53
sp|Q50167|OTSA_MYCLE Trehalose-phosphate synthase OS=Mycobacterium leprae (strain TN) GN=otsA PE=3 SV=1 496 860 9.0E-53
sp|A4WBR1|OTSA_ENT38 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Enterobacter sp. (strain 638) GN=otsA PE=3 SV=1 461 845 3.0E-52
sp|A1TFL3|OTSA_MYCVP Trehalose-phosphate synthase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=otsA PE=3 SV=1 493 839 4.0E-52
sp|A0QAK7|OTSA_MYCA1 Trehalose-phosphate synthase OS=Mycobacterium avium (strain 104) GN=otsA PE=3 SV=1 493 839 7.0E-52
sp|Q743L8|OTSA_MYCPA Trehalose-phosphate synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=otsA PE=3 SV=1 493 839 1.0E-51
sp|P55612|OTSA_RHISN Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Rhizobium sp. (strain NGR234) GN=otsA PE=3 SV=1 470 839 1.0E-51
sp|P0CL06|OTSA_SALTY Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=otsA PE=3 SV=1 470 850 2.0E-51
sp|E1WGG8|OTSA_SALTS Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella typhimurium (strain SL1344) GN=otsA PE=3 SV=1 470 850 2.0E-51
sp|P0A1Q1|OTSA_SALTI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella typhi GN=otsA PE=3 SV=2 470 850 2.0E-51
sp|A9MU86|OTSA_SALPB Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=otsA PE=3 SV=1 470 850 2.0E-51
sp|Q5PMW8|OTSA_SALPA Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=otsA PE=3 SV=1 470 850 2.0E-51
sp|A3Q6H9|OTSA_MYCSJ Trehalose-phosphate synthase OS=Mycobacterium sp. (strain JLS) GN=otsA PE=3 SV=1 493 839 2.0E-51
sp|Q57N70|OTSA_SALCH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella choleraesuis (strain SC-B67) GN=otsA PE=3 SV=1 470 850 3.0E-51
sp|A9MMQ2|OTSA_SALAR Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=otsA PE=3 SV=2 470 850 6.0E-51
sp|A1KPH5|OTSA_MYCBP Trehalose-phosphate synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=otsA PE=3 SV=1 493 839 9.0E-51
sp|Q7TWE1|OTSA_MYCBO Trehalose-phosphate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=otsA PE=3 SV=1 493 839 9.0E-51
sp|A4T7Q6|OTSA_MYCGI Trehalose-phosphate synthase OS=Mycobacterium gilvum (strain PYR-GCK) GN=otsA PE=3 SV=1 470 839 1.0E-50
sp|P9WN11|OTSA_MYCTU Trehalose-phosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=otsA PE=1 SV=1 493 839 3.0E-50
sp|P9WN10|OTSA_MYCTO Trehalose-phosphate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=otsA PE=3 SV=1 493 839 3.0E-50
sp|A5U8G5|OTSA_MYCTA Trehalose-phosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=otsA PE=3 SV=1 493 839 3.0E-50
sp|O65979|GGPS_SYNP2 Glucosylglycerol-phosphate synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=ggpS PE=2 SV=2 496 862 4.0E-50
sp|B2HHY2|OTSA_MYCMM Trehalose-phosphate synthase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=otsA PE=3 SV=1 493 839 6.0E-50
sp|A0PUT6|OTSA_MYCUA Trehalose-phosphate synthase OS=Mycobacterium ulcerans (strain Agy99) GN=otsA PE=3 SV=1 493 839 8.0E-50
sp|A6TB47|OTSA_KLEP7 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=otsA PE=3 SV=1 470 850 2.0E-49
sp|Q1B321|OTSA_MYCSS Trehalose-phosphate synthase OS=Mycobacterium sp. (strain MCS) GN=otsA PE=3 SV=1 493 839 6.0E-49
sp|A1UM30|OTSA_MYCSK Trehalose-phosphate synthase OS=Mycobacterium sp. (strain KMS) GN=otsA PE=3 SV=1 493 839 6.0E-49
sp|Q2NTK9|OTSA_SODGM Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Sodalis glossinidius (strain morsitans) GN=otsA PE=3 SV=1 479 857 2.0E-47
sp|Q93JY3|GGPS_PSEAG Glucosylglycerol-phosphate synthase OS=Pseudomonas anguilliseptica GN=ggpS PE=3 SV=2 496 839 2.0E-46
sp|A8AFD4|OTSA_CITK8 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=otsA PE=3 SV=2 461 850 3.0E-46
sp|Q3Z2S4|OTSA_SHISS Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Shigella sonnei (strain Ss046) GN=otsA PE=3 SV=1 470 839 1.0E-43
sp|Q32H58|OTSA_SHIDS Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=otsA PE=3 SV=1 470 839 1.0E-43
sp|B1LQW0|OTSA_ECOSM Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=otsA PE=3 SV=1 470 839 1.0E-43
sp|P31677|OTSA_ECOLI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli (strain K12) GN=otsA PE=1 SV=3 470 839 1.0E-43
sp|B1J0J4|OTSA_ECOLC Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=otsA PE=3 SV=1 470 839 1.0E-43
sp|B1X658|OTSA_ECODH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli (strain K12 / DH10B) GN=otsA PE=3 SV=1 470 839 1.0E-43
sp|A7ZN22|OTSA_ECO24 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=otsA PE=3 SV=1 470 839 1.0E-43
sp|A8A1A0|OTSA_ECOHS Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli O9:H4 (strain HS) GN=otsA PE=3 SV=1 470 839 2.0E-43
sp|Q8XCE7|OTSA_ECO57 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli O157:H7 GN=otsA PE=3 SV=3 470 839 2.0E-43
sp|Q8FGN6|OTSA_ECOL6 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=otsA PE=3 SV=2 467 839 4.0E-43
sp|Q0TGU0|OTSA_ECOL5 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=otsA PE=3 SV=1 467 839 4.0E-43
sp|Q1RAP1|OTSA_ECOUT Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli (strain UTI89 / UPEC) GN=otsA PE=3 SV=2 467 839 5.0E-43
sp|A1AC53|OTSA_ECOK1 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Escherichia coli O1:K1 / APEC GN=otsA PE=3 SV=2 467 839 5.0E-43
sp|Q6JTB2|OTSA_PSESS Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Pseudomonas savastanoi GN=otsA PE=3 SV=1 470 839 7.0E-43
sp|O45380|TPS2_CAEEL Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Caenorhabditis elegans GN=tps-2 PE=2 SV=3 475 839 3.0E-26
sp|Q7YZT6|TPS1_CAEEL Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Caenorhabditis elegans GN=tps-1 PE=2 SV=1 493 794 3.0E-21
sp|Q5K2C1|TPS2_APHAV Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Aphelenchus avenae GN=tps-2 PE=2 SV=1 495 839 7.0E-21
sp|Q5K2C4|TPS1_APHAV Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Aphelenchus avenae GN=tps-1 PE=2 SV=1 495 839 7.0E-21
sp|A8WRG3|TPS1_CAEBR Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Caenorhabditis briggsae GN=tps-1 PE=3 SV=2 471 794 8.0E-21
sp|Q49734|OTSB_MYCLE Trehalose-phosphate phosphatase OS=Mycobacterium leprae (strain TN) GN=otsB PE=3 SV=1 865 1094 4.0E-12
sp|Q6ZAL2|TPP6_ORYSJ Probable trehalose-phosphate phosphatase 6 OS=Oryza sativa subsp. japonica GN=TPP6 PE=2 SV=1 874 1139 1.0E-11
sp|Q6ZGP8|TPP4_ORYSJ Probable trehalose-phosphate phosphatase 4 OS=Oryza sativa subsp. japonica GN=TPP4 PE=2 SV=1 873 1133 1.0E-11
sp|Q8SSL0|TPP_ENCCU Probable trehalose-phosphatase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_0870 PE=1 SV=1 866 1130 9.0E-11
sp|Q9FWQ2|TPP2_ORYSJ Probable trehalose-phosphate phosphatase 2 OS=Oryza sativa subsp. japonica GN=TPP2 PE=1 SV=1 876 1139 1.0E-10
sp|Q6H5L4|TPP7_ORYSJ Probable trehalose-phosphate phosphatase 7 OS=Oryza sativa subsp. japonica GN=TPP7 PE=2 SV=2 874 1133 2.0E-10
sp|Q0DDI1|TPP8_ORYSJ Probable trehalose-phosphate phosphatase 8 OS=Oryza sativa subsp. japonica GN=TPP8 PE=2 SV=3 874 1130 3.0E-10
sp|Q0D6F4|TPP10_ORYSJ Probable trehalose-phosphate phosphatase 10 OS=Oryza sativa subsp. japonica GN=TPP10 PE=2 SV=1 876 1133 1.0E-09
sp|Q67XC9|TPPD_ARATH Probable trehalose-phosphate phosphatase D OS=Arabidopsis thaliana GN=TPPD PE=2 SV=1 874 1139 2.0E-09
sp|O64896|TPPA_ARATH Trehalose-phosphate phosphatase A OS=Arabidopsis thaliana GN=TPPA PE=1 SV=1 876 1146 2.0E-09
sp|Q10KF5|TPP9_ORYSJ Probable trehalose-phosphate phosphatase 9 OS=Oryza sativa subsp. japonica GN=TPP9 PE=3 SV=1 874 1131 3.0E-09
sp|P0CL50|OTSB_SALTY Trehalose-phosphate phosphatase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=otsB PE=3 SV=1 880 1131 4.0E-09
sp|B2HDP8|OTSB_MYCMM Trehalose-phosphate phosphatase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=otsB PE=3 SV=1 880 1146 6.0E-09
sp|Q7XI41|TPP3_ORYSJ Probable trehalose-phosphate phosphatase 3 OS=Oryza sativa subsp. japonica GN=TPP3 PE=2 SV=1 874 1139 7.0E-09
sp|Q67X99|TPPE_ARATH Probable trehalose-phosphate phosphatase E OS=Arabidopsis thaliana GN=TPPE PE=2 SV=1 872 1132 1.0E-08
sp|Q8GWG2|TPPH_ARATH Probable trehalose-phosphate phosphatase H OS=Arabidopsis thaliana GN=TPPH PE=2 SV=1 874 1133 1.0E-08
sp|P9WFZ5|OTSB_MYCTU Trehalose-phosphate phosphatase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=otsB PE=1 SV=1 865 1091 2.0E-08
sp|P9WFZ4|OTSB_MYCTO Trehalose-phosphate phosphatase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=otsB PE=3 SV=1 865 1091 2.0E-08
sp|A5U846|OTSB_MYCTA Trehalose-phosphate phosphatase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=otsB PE=3 SV=1 865 1091 2.0E-08
sp|A1KP65|OTSB_MYCBP Trehalose-phosphate phosphatase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=otsB PE=3 SV=1 865 1091 2.0E-08
sp|Q7TWL7|OTSB_MYCBO Trehalose-phosphate phosphatase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=otsB PE=3 SV=1 865 1091 2.0E-08
sp|Q75WV3|TPP1_ORYSJ Probable trehalose-phosphate phosphatase 1 OS=Oryza sativa subsp. japonica GN=TPP1 PE=1 SV=1 876 1139 6.0E-08
sp|E1WGG9|OTSB_SALTS Trehalose-phosphate phosphatase OS=Salmonella typhimurium (strain SL1344) GN=otsB PE=3 SV=1 880 1131 6.0E-08
sp|Q9C9S4|TPPB_ARATH Trehalose-phosphate phosphatase B OS=Arabidopsis thaliana GN=TPPB PE=1 SV=1 874 1131 1.0E-07
sp|F4I1A6|TPPC_ARATH Probable trehalose-phosphate phosphatase C OS=Arabidopsis thaliana GN=TPPC PE=2 SV=1 874 1133 2.0E-07
sp|A0PMI0|OTSB_MYCUA Trehalose-phosphate phosphatase OS=Mycobacterium ulcerans (strain Agy99) GN=otsB PE=3 SV=1 880 1146 2.0E-07
sp|P55611|OTSB_RHISN Probable trehalose-phosphate phosphatase OS=Rhizobium sp. (strain NGR234) GN=otsB PE=3 SV=1 880 1103 3.0E-07
sp|Q9SUW0|TPPG_ARATH Probable trehalose-phosphate phosphatase G OS=Arabidopsis thaliana GN=TPPG PE=2 SV=1 873 1131 4.0E-07
sp|F4KFG5|TPPI_ARATH Probable trehalose-phosphate phosphatase I OS=Arabidopsis thaliana GN=TPPI PE=2 SV=1 802 1133 4.0E-07
sp|Q7XT34|TPP5_ORYSJ Probable trehalose-phosphate phosphatase 5 OS=Oryza sativa subsp. japonica GN=TPP5 PE=3 SV=2 877 1094 4.0E-07
sp|P31678|OTSB_ECOLI Trehalose-6-phosphate phosphatase OS=Escherichia coli (strain K12) GN=otsB PE=1 SV=2 875 1141 8.0E-07
sp|Q9SU39|TPPF_ARATH Probable trehalose-phosphate phosphatase F OS=Arabidopsis thaliana GN=TPPF PE=2 SV=1 881 1139 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0005992 trehalose biosynthetic process Yes
GO:0008150 biological_process No
GO:0046351 disaccharide biosynthetic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0005991 trehalose metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0009312 oligosaccharide biosynthetic process No
GO:0034637 cellular carbohydrate biosynthetic process No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0005984 disaccharide metabolic process No
GO:0009311 oligosaccharide metabolic process No
GO:0044237 cellular metabolic process No
GO:0016051 carbohydrate biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6904 0.4354 0.3536 0.0864 0.1704 0.0215 0.0758 0.1326 0.1214 0.05

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT20 4.8E-152 305 846

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup489
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4071
Ophiocordyceps australis map64 (Brazil) OphauB2|7163
Ophiocordyceps camponoti-floridani Ophcf2|03847
Ophiocordyceps camponoti-floridani Ophcf2|05929
Ophiocordyceps camponoti-rufipedis Ophun1|3698
Ophiocordyceps camponoti-rufipedis Ophun1|5223
Ophiocordyceps kimflemingae Ophio5|6531
Ophiocordyceps subramaniannii Hirsu2|10969 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10969
MAGDSAVRSLGPAETAPVLQDPAPLLQRQRDKTPELPEPPRDTFIKHHLHPRRDLTGPADCDRSSRDDAHDADRG
SSSERSSSGSGSGSGASSGTAAASSTRSSSRDPGPGTGTARPDPPATIATAASPPPLGAAVPVPSNCRTALWEPR
LGLGQLHPQQPQAHGPNSYYDTVTPGIHPSTYIDPFSSASSASAASSVDLFARRPVRSPLLAAAAPPARETPQPT
SSAAAGDGDSACRRRSTGGDTGYFALPPRPQPDARSPRLRRRADDDSDDRPPSASARPRTRPAVMARRESLSELR
AANPELSLSGNIISATFNLPHALTYCKNGDWELKPRRGQSALFDAFAYLSSDATAWNHTVVAWTGEIESPHDRAA
SPAPDAARPSTTVGAASLNALSAPVPVDVDGHARLPTPPPHDGLWIPSEDQARLEHRLSHGAAVRAVPVWLADDA
ERPGHGGGIMLRDQARWRRYAQHDLATLFHYKQNEPSDGRRERVQWADYYRMNQMFANKIIDVYRPGDVVIVHDY
FLMLLPSMLRQRVPGMYISFFLHCPFPSSEFVRCLPRRKEVLEGVLGANLVGFQSYSYSRHFLSCCTRILGFPSD
TLGIDAYGSRVQVGVFPIGIDAAKVEAFAWADSVSAKHDALRKLYAGKKIIVGRDRLDSVRGVAQKLQAFERFLE
MYPEWRERVVLIQVTSPTTAAEADRDDAEGRVGSRVNELVMKINGQYGSLGFSPVQHYPQYLTQDEYFALLRAAD
IGLITSVRDGMNTTSLEYVVCQKDGHGPLILSEFSGTAGSLADAIHINPWDLSGVAERINAALTMPRDQRESMQR
RLYRHVTRHNAQSWIGKLIRKAHSVLGEAGAVEATPLLDRALLLSQYRSAGKRLFMFDYDGTLTPIVREPSAAIP
SERIIHSLRLLAADARNAVWIISGRDQDFLGHHLGHIPQLGFSAEHGSFMRYPATEEWVNLAEKFDMGWQTEVMD
VFQRYTDKVSGSFIERKRCALTWHYRLADPELGLHMARECQKELEAGVGRRWEVEVMPGKANIEVRPTFINKGEI
AKRLVATYHNPEAQPSESDPNPGKVEFALCMGDDFTDEDMFRSLNGASGATLKADHVFTVTVGASTKVTLAKWHL
LEPEDVIECVALLAVAEGPLGSEKMGEVNLAALSTVEGHIPSGET*
Coding >Hirsu2|10969
ATGGCGGGCGATAGCGCTGTCCGGTCGCTGGGGCCTGCCGAGACAGCGCCCGTCCTGCAGGACCCCGCGCCGCTT
CTGCAGCGGCAGCGAGACAAGACCCCAGAGCTGCCGGAGCCCCCCCGCGATACCTTCATCAAGCACCACCTCCAT
CCTCGCCGCGACCTCACCGGGCCCGCCGATTGCGACCGCAGCAGCAGAGACGACGCTCACGACGCAGACCGCGGC
AGCAGCAGCGAGCGTAGCAGCTCCGGCTCCGGCTCCGGCTCCGGCGCCAGCTCCGGCACCGCCGCCGCCAGCAGC
ACCCGCAGCTCCAGCCGCGACCCGGGCCCAGGCACAGGCACAGCTCGCCCGGATCCACCGGCGACGATAGCGACA
GCTGCCTCCCCGCCGCCCCTCGGCGCCGCGGTCCCAGTGCCGAGCAATTGTCGAACGGCCCTGTGGGAGCCCAGG
CTAGGCCTAGGCCAGCTCCATCCCCAGCAGCCCCAGGCCCACGGCCCCAACAGCTATTACGACACCGTCACCCCC
GGCATCCATCCCTCGACATACATCGACCCCTTCTCCTCCGCCTCGTCCGCCTCCGCCGCCTCGTCCGTCGACCTC
TTCGCCCGCCGTCCCGTGCGCTCGCCGCTGCTCGCCGCCGCCGCGCCCCCGGCCCGCGAGACTCCTCAGCCGACC
AGCTCCGCCGCCGCCGGAGACGGTGACAGCGCCTGTCGTCGTCGCTCGACCGGCGGCGACACCGGCTACTTCGCC
CTGCCGCCGCGCCCGCAGCCCGACGCCCGCAGTCCTCGGCTTCGCCGCCGCGCCGACGACGACTCGGACGATCGG
CCGCCCTCCGCCTCGGCCCGCCCGCGTACTCGTCCTGCTGTCATGGCCCGCCGTGAGTCGCTGTCCGAGCTTCGC
GCCGCCAACCCGGAGCTGTCGCTCAGCGGAAACATAATCTCGGCCACCTTCAACCTCCCGCATGCTCTGACGTAC
TGCAAGAACGGCGATTGGGAACTCAAGCCGCGTCGCGGCCAGTCTGCCCTGTTCGACGCCTTCGCCTACCTGTCG
TCGGACGCGACGGCCTGGAACCACACCGTCGTCGCCTGGACGGGCGAGATCGAGTCGCCTCACGACCGCGCCGCG
TCGCCTGCGCCCGACGCCGCCCGCCCGTCGACGACGGTCGGTGCCGCCTCGCTCAATGCGCTCTCGGCCCCCGTC
CCCGTCGACGTCGACGGCCACGCGCGCCTGCCTACGCCGCCTCCGCATGACGGGCTCTGGATCCCCAGCGAGGAC
CAGGCCCGGCTCGAGCACCGCCTCTCCCACGGCGCCGCCGTCCGCGCCGTCCCCGTCTGGCTGGCCGACGACGCC
GAGCGCCCGGGCCATGGTGGCGGCATCATGCTCCGCGACCAGGCGCGCTGGCGCCGCTACGCCCAGCACGACCTG
GCCACCCTCTTCCACTACAAGCAGAACGAGCCGTCGGACGGGCGGCGCGAGCGCGTCCAGTGGGCCGACTACTAC
CGCATGAACCAGATGTTCGCCAACAAGATCATCGACGTCTACCGGCCCGGCGACGTCGTCATCGTCCACGACTAC
TTCCTCATGCTGCTGCCCAGCATGCTGCGCCAGCGCGTGCCCGGCATGTACATCTCCTTCTTCCTCCACTGCCCC
TTTCCCAGCAGCGAGTTCGTCCGCTGCCTGCCGCGTCGCAAGGAGGTGCTCGAGGGCGTCCTGGGCGCCAACCTG
GTCGGCTTCCAGTCGTACAGCTACTCGCGCCACTTCCTCAGCTGCTGCACCCGCATCCTCGGCTTCCCCTCGGAC
ACGCTCGGCATCGACGCCTACGGCTCGCGCGTTCAGGTTGGCGTCTTCCCCATCGGCATCGACGCCGCCAAGGTC
GAGGCCTTCGCCTGGGCCGACTCCGTCTCGGCCAAGCACGACGCGCTGCGCAAGCTGTACGCCGGCAAGAAGATC
ATCGTCGGCCGCGACCGGCTCGACAGCGTGCGCGGCGTGGCCCAGAAGCTGCAGGCCTTTGAGCGCTTCCTCGAG
ATGTACCCCGAGTGGCGCGAGCGCGTCGTGCTCATCCAGGTCACGTCGCCCACCACGGCGGCCGAGGCCGACCGG
GACGACGCCGAGGGCCGCGTCGGCAGCCGCGTCAACGAGCTCGTCATGAAGATCAACGGCCAGTACGGCAGCCTC
GGCTTCTCGCCCGTCCAGCACTACCCGCAGTACCTAACGCAGGACGAGTACTTTGCGCTCCTGCGCGCGGCCGAC
ATCGGCCTCATCACCTCGGTGCGCGACGGCATGAACACGACGAGCCTCGAGTACGTCGTCTGCCAGAAGGACGGC
CACGGGCCGCTCATCCTGTCCGAGTTCAGCGGCACGGCCGGCAGCCTGGCCGACGCCATCCACATCAACCCCTGG
GACCTGAGCGGCGTGGCCGAGAGGATCAACGCGGCGCTGACGATGCCGCGCGACCAGCGCGAGTCGATGCAGCGC
CGCCTCTACCGGCACGTCACCCGGCACAACGCGCAGTCGTGGATCGGCAAGCTCATCCGCAAGGCGCACAGCGTG
CTGGGCGAGGCCGGCGCCGTCGAGGCGACGCCGCTGCTGGACCGCGCCCTGCTGCTGTCGCAGTACCGCTCGGCC
GGCAAGCGGCTCTTCATGTTCGACTACGACGGCACGCTGACGCCCATCGTGCGCGAGCCCAGCGCGGCCATCCCC
TCGGAGCGCATCATCCACTCGCTCCGCCTGCTCGCGGCCGACGCCCGCAACGCCGTCTGGATCATCTCGGGCCGC
GACCAGGACTTCCTCGGCCACCACCTCGGCCACATCCCCCAGCTCGGCTTCTCCGCCGAGCACGGCAGCTTCATG
CGCTACCCGGCGACGGAGGAGTGGGTGAACCTGGCGGAGAAGTTCGACATGGGCTGGCAGACGGAGGTCATGGAC
GTGTTTCAAAGGTATACGGACAAGGTCTCTGGATCCTTCATCGAGCGCAAACGGTGCGCGCTCACGTGGCACTAC
CGGCTCGCGGACCCGGAGCTGGGACTGCACATGGCGCGCGAGTGCCAGAAAGAGCTCGAGGCCGGGGTGGGACGG
CGGTGGGAGGTGGAGGTGATGCCGGGCAAGGCCAACATCGAGGTGCGGCCGACCTTCATCAACAAGGGCGAGATC
GCCAAGCGGCTGGTGGCGACGTACCACAACCCGGAGGCGCAGCCGAGCGAGAGCGACCCGAACCCCGGCAAGGTC
GAGTTCGCGCTGTGCATGGGCGACGACTTCACGGACGAGGACATGTTCCGCAGCCTCAACGGGGCGTCCGGGGCG
ACGCTCAAGGCCGACCACGTCTTCACCGTGACGGTGGGGGCGAGCACCAAGGTGACGCTGGCCAAGTGGCACCTG
CTGGAGCCCGAGGACGTGATCGAGTGCGTGGCCCTGCTGGCGGTAGCCGAGGGCCCGCTGGGCTCGGAGAAGATG
GGCGAGGTCAACCTGGCGGCGCTGAGCACGGTCGAGGGACACATTCCGTCGGGCGAGACATGA
Transcript >Hirsu2|10969
ATGGCGGGCGATAGCGCTGTCCGGTCGCTGGGGCCTGCCGAGACAGCGCCCGTCCTGCAGGACCCCGCGCCGCTT
CTGCAGCGGCAGCGAGACAAGACCCCAGAGCTGCCGGAGCCCCCCCGCGATACCTTCATCAAGCACCACCTCCAT
CCTCGCCGCGACCTCACCGGGCCCGCCGATTGCGACCGCAGCAGCAGAGACGACGCTCACGACGCAGACCGCGGC
AGCAGCAGCGAGCGTAGCAGCTCCGGCTCCGGCTCCGGCTCCGGCGCCAGCTCCGGCACCGCCGCCGCCAGCAGC
ACCCGCAGCTCCAGCCGCGACCCGGGCCCAGGCACAGGCACAGCTCGCCCGGATCCACCGGCGACGATAGCGACA
GCTGCCTCCCCGCCGCCCCTCGGCGCCGCGGTCCCAGTGCCGAGCAATTGTCGAACGGCCCTGTGGGAGCCCAGG
CTAGGCCTAGGCCAGCTCCATCCCCAGCAGCCCCAGGCCCACGGCCCCAACAGCTATTACGACACCGTCACCCCC
GGCATCCATCCCTCGACATACATCGACCCCTTCTCCTCCGCCTCGTCCGCCTCCGCCGCCTCGTCCGTCGACCTC
TTCGCCCGCCGTCCCGTGCGCTCGCCGCTGCTCGCCGCCGCCGCGCCCCCGGCCCGCGAGACTCCTCAGCCGACC
AGCTCCGCCGCCGCCGGAGACGGTGACAGCGCCTGTCGTCGTCGCTCGACCGGCGGCGACACCGGCTACTTCGCC
CTGCCGCCGCGCCCGCAGCCCGACGCCCGCAGTCCTCGGCTTCGCCGCCGCGCCGACGACGACTCGGACGATCGG
CCGCCCTCCGCCTCGGCCCGCCCGCGTACTCGTCCTGCTGTCATGGCCCGCCGTGAGTCGCTGTCCGAGCTTCGC
GCCGCCAACCCGGAGCTGTCGCTCAGCGGAAACATAATCTCGGCCACCTTCAACCTCCCGCATGCTCTGACGTAC
TGCAAGAACGGCGATTGGGAACTCAAGCCGCGTCGCGGCCAGTCTGCCCTGTTCGACGCCTTCGCCTACCTGTCG
TCGGACGCGACGGCCTGGAACCACACCGTCGTCGCCTGGACGGGCGAGATCGAGTCGCCTCACGACCGCGCCGCG
TCGCCTGCGCCCGACGCCGCCCGCCCGTCGACGACGGTCGGTGCCGCCTCGCTCAATGCGCTCTCGGCCCCCGTC
CCCGTCGACGTCGACGGCCACGCGCGCCTGCCTACGCCGCCTCCGCATGACGGGCTCTGGATCCCCAGCGAGGAC
CAGGCCCGGCTCGAGCACCGCCTCTCCCACGGCGCCGCCGTCCGCGCCGTCCCCGTCTGGCTGGCCGACGACGCC
GAGCGCCCGGGCCATGGTGGCGGCATCATGCTCCGCGACCAGGCGCGCTGGCGCCGCTACGCCCAGCACGACCTG
GCCACCCTCTTCCACTACAAGCAGAACGAGCCGTCGGACGGGCGGCGCGAGCGCGTCCAGTGGGCCGACTACTAC
CGCATGAACCAGATGTTCGCCAACAAGATCATCGACGTCTACCGGCCCGGCGACGTCGTCATCGTCCACGACTAC
TTCCTCATGCTGCTGCCCAGCATGCTGCGCCAGCGCGTGCCCGGCATGTACATCTCCTTCTTCCTCCACTGCCCC
TTTCCCAGCAGCGAGTTCGTCCGCTGCCTGCCGCGTCGCAAGGAGGTGCTCGAGGGCGTCCTGGGCGCCAACCTG
GTCGGCTTCCAGTCGTACAGCTACTCGCGCCACTTCCTCAGCTGCTGCACCCGCATCCTCGGCTTCCCCTCGGAC
ACGCTCGGCATCGACGCCTACGGCTCGCGCGTTCAGGTTGGCGTCTTCCCCATCGGCATCGACGCCGCCAAGGTC
GAGGCCTTCGCCTGGGCCGACTCCGTCTCGGCCAAGCACGACGCGCTGCGCAAGCTGTACGCCGGCAAGAAGATC
ATCGTCGGCCGCGACCGGCTCGACAGCGTGCGCGGCGTGGCCCAGAAGCTGCAGGCCTTTGAGCGCTTCCTCGAG
ATGTACCCCGAGTGGCGCGAGCGCGTCGTGCTCATCCAGGTCACGTCGCCCACCACGGCGGCCGAGGCCGACCGG
GACGACGCCGAGGGCCGCGTCGGCAGCCGCGTCAACGAGCTCGTCATGAAGATCAACGGCCAGTACGGCAGCCTC
GGCTTCTCGCCCGTCCAGCACTACCCGCAGTACCTAACGCAGGACGAGTACTTTGCGCTCCTGCGCGCGGCCGAC
ATCGGCCTCATCACCTCGGTGCGCGACGGCATGAACACGACGAGCCTCGAGTACGTCGTCTGCCAGAAGGACGGC
CACGGGCCGCTCATCCTGTCCGAGTTCAGCGGCACGGCCGGCAGCCTGGCCGACGCCATCCACATCAACCCCTGG
GACCTGAGCGGCGTGGCCGAGAGGATCAACGCGGCGCTGACGATGCCGCGCGACCAGCGCGAGTCGATGCAGCGC
CGCCTCTACCGGCACGTCACCCGGCACAACGCGCAGTCGTGGATCGGCAAGCTCATCCGCAAGGCGCACAGCGTG
CTGGGCGAGGCCGGCGCCGTCGAGGCGACGCCGCTGCTGGACCGCGCCCTGCTGCTGTCGCAGTACCGCTCGGCC
GGCAAGCGGCTCTTCATGTTCGACTACGACGGCACGCTGACGCCCATCGTGCGCGAGCCCAGCGCGGCCATCCCC
TCGGAGCGCATCATCCACTCGCTCCGCCTGCTCGCGGCCGACGCCCGCAACGCCGTCTGGATCATCTCGGGCCGC
GACCAGGACTTCCTCGGCCACCACCTCGGCCACATCCCCCAGCTCGGCTTCTCCGCCGAGCACGGCAGCTTCATG
CGCTACCCGGCGACGGAGGAGTGGGTGAACCTGGCGGAGAAGTTCGACATGGGCTGGCAGACGGAGGTCATGGAC
GTGTTTCAAAGGTATACGGACAAGGTCTCTGGATCCTTCATCGAGCGCAAACGGTGCGCGCTCACGTGGCACTAC
CGGCTCGCGGACCCGGAGCTGGGACTGCACATGGCGCGCGAGTGCCAGAAAGAGCTCGAGGCCGGGGTGGGACGG
CGGTGGGAGGTGGAGGTGATGCCGGGCAAGGCCAACATCGAGGTGCGGCCGACCTTCATCAACAAGGGCGAGATC
GCCAAGCGGCTGGTGGCGACGTACCACAACCCGGAGGCGCAGCCGAGCGAGAGCGACCCGAACCCCGGCAAGGTC
GAGTTCGCGCTGTGCATGGGCGACGACTTCACGGACGAGGACATGTTCCGCAGCCTCAACGGGGCGTCCGGGGCG
ACGCTCAAGGCCGACCACGTCTTCACCGTGACGGTGGGGGCGAGCACCAAGGTGACGCTGGCCAAGTGGCACCTG
CTGGAGCCCGAGGACGTGATCGAGTGCGTGGCCCTGCTGGCGGTAGCCGAGGGCCCGCTGGGCTCGGAGAAGATG
GGCGAGGTCAACCTGGCGGCGCTGAGCACGGTCGAGGGACACATTCCGTCGGGCGAGACATGA
Gene >Hirsu2|10969
ATGGCGGGCGATAGCGCTGTCCGGTCGCTGGGGCCTGCCGAGACAGCGCCCGTCCTGCAGGACCCCGCGCCGCTT
CTGCAGCGGCAGCGAGACAAGACCCCAGAGCTGCCGGAGCCCCCCCGCGATACCTTCATCAAGCACCACCTCCAT
CCTCGCCGCGACCTCACCGGGCCCGCCGATTGCGACCGCAGCAGCAGAGACGACGCTCACGACGCAGACCGCGGC
AGCAGCAGCGAGCGTAGCAGCTCCGGCTCCGGCTCCGGCTCCGGCGCCAGCTCCGGCACCGCCGCCGCCAGCAGC
ACCCGCAGCTCCAGCCGCGACCCGGGCCCAGGCACAGGCACAGCTCGCCCGGATCCACCGGCGACGATAGCGACA
GCTGCCTCCCCGCCGCCCCTCGGCGCCGCGGTCCCAGTGCCGAGCAATTGTCGAACGGCCCTGTGGGAGCCCAGG
CTAGGCCTAGGCCAGCTCCATCCCCAGCAGCCCCAGGCCCACGGCCCCAACAGCTATTACGACACCGTCACCCCC
GGCATCCATCCCTCGACATACATCGACCCCTTCTCCTCCGCCTCGTCCGCCTCCGCCGCCTCGTCCGTCGACCTC
TTCGCCCGCCGTCCCGTGCGCTCGCCGCTGCTCGCCGCCGCCGCGCCCCCGGCCCGCGAGACTCCTCAGCCGACC
AGCTCCGCCGCCGCCGGAGACGGTGACAGCGCCTGTCGTCGTCGCTCGACCGGCGGCGACACCGGCTACTTCGCC
CTGCCGCCGCGCCCGCAGCCCGACGCCCGCAGTCCTCGGCTTCGCCGCCGCGCCGACGACGACTCGGACGATCGG
CCGCCCTCCGCCTCGGCCCGCCCGCGTACTCGTCCTGCTGTCATGGCCCGCCGTGAGTCGCTGTCCGAGCTTCGC
GCCGCCAACCCGGAGCTGTCGCTCAGCGGAAACATAATCTCGGCCACCTTCAACCTCCCGCATGCTCTGACGTAC
TGCAAGAACGGCGATTGGGTGAGTGAGACATGCACACCACCACCTTGCATCCCATCCCTGACTCCTGTCTCTGTC
TCTCCTTTTTCTTTTTTTTTTTAATTTTCATTCGCCGCGCCCCCGGCAACTCGCCCACGAGGCGCGCGTGCCCAT
GCGACACGATCGACGCTGACGCTCTCGTCCCGTAGGAACTCAAGCCGCGTCGCGGCCAGTCTGCCCTGTTCGACG
CCTTCGCCTACCTGTCGTCGGACGCGACGGCCTGGAACCACACCGTCGTCGCCTGGACGGGCGAGATCGAGTCGC
CTCACGACCGCGCCGCGTCGCCTGCGCCCGACGCCGCCCGCCCGTCGACGACGGTCGGTGCCGCCTCGCTCAATG
CGCTCTCGGCCCCCGTCCCCGTCGACGTCGACGGCCACGCGCGCCTGCCTACGCCGCCTCCGCATGACGGGCTCT
GGATCCCCAGCGAGGACCAGGCCCGGCTCGAGCACCGCCTCTCCCACGGCGCCGCCGTCCGCGCCGTCCCCGTCT
GGCTGGCCGACGACGCCGAGCGCCCGGGCCATGGTGGCGGCATCATGCTCCGCGACCAGGCGCGCTGGCGCCGCT
ACGCCCAGCACGACCTGGCCACCCTCTTCCACTACAAGCAGAACGAGCCGTCGGACGGGCGGCGCGAGCGCGTCC
AGTGGGCCGACTACTACCGCATGAACCAGATGTTCGCCAACAAGATCATCGACGTCTACCGGCCCGGCGACGTCG
TCATCGTCCACGACTACTTCCTCATGCTGCTGCCCAGCATGCTGCGCCAGCGCGTGCCCGGCATGTACATCTCCT
TCTTCCTCCACTGCCCCTTTCCCAGCAGCGAGTTCGTCCGCTGCCTGCCGCGTCGCAAGGAGGTGCTCGAGGGCG
TCCTGGGCGCCAACCTGGTCGGCTTCCAGTCGTACAGCTACTCGCGCCACTTCCTCAGCTGCTGCACCCGCATCC
TCGGCTTCCCCTCGGACACGCTCGGCATCGACGCCTACGGCTCGCGCGTTCAGGTTGGCGTCTTCCCCATCGGCA
TCGACGCCGCCAAGGTCGAGGCCTTCGCCTGGGCCGACTCCGTCTCGGCCAAGCACGACGCGCTGCGCAAGCTGT
ACGCCGGCAAGAAGATCATCGTCGGCCGCGACCGGCTCGACAGCGTGCGCGGCGTGGCCCAGAAGCTGCAGGCCT
TTGAGCGCTTCCTCGAGATGTACCCCGAGTGGCGCGAGCGCGTCGTGCTCATCCAGGTCACGTCGCCCACCACGG
CGGCCGAGGCCGACCGGGACGACGCCGAGGGCCGCGTCGGCAGCCGCGTCAACGAGCTCGTCATGAAGATCAACG
GCCAGTACGGCAGCCTCGGCTTCTCGCCCGTCCAGCACTACCCGCAGTACCTAACGCAGGACGAGTACTTTGCGC
TCCTGCGCGCGGCCGACATCGGCCTCATCACCTCGGTGCGCGACGGCATGAACACGACGAGCCTCGAGTACGTCG
TCTGCCAGAAGGACGGCCACGGGCCGCTCATCCTGTCCGAGTTCAGCGGCACGGCCGGCAGCCTGGCCGACGCCA
TCCACATCAACCCCTGGGACCTGAGCGGCGTGGCCGAGAGGATCAACGCGGCGCTGACGATGCCGCGCGACCAGC
GCGAGTCGATGCAGCGCCGCCTCTACCGGCACGTCACCCGGCACAACGCGCAGTCGTGGATCGGCAAGCTCATCC
GCAAGGCGCACAGCGTGCTGGGCGAGGCCGGCGCCGTCGAGGCGACGCCGCTGCTGGACCGCGCCCTGCTGCTGT
CGCAGTACCGCTCGGCCGGCAAGCGGCTCTTCATGTTCGACTACGACGGCACGCTGACGCCCATCGTGCGCGAGC
CCAGCGCGGCCATCCCCTCGGAGCGCATCATCCACTCGCTCCGCCTGCTCGCGGCCGACGCCCGCAACGCCGTCT
GGATCATCTCGGGCCGCGACCAGGACTTCCTCGGCCACCACCTCGGCCACATCCCCCAGCTCGGCTTCTCCGCCG
AGCACGGCAGCTTCATGCGCTACCCGGCGACGGAGGAGTGGGTGAACCTGGCGGAGAAGTTCGACATGGGCTGGC
AGACGGAGGTCATGGACGTGTTTCAAAGGTATACGGACAAGGTCTCTGGTGAGTGTCTCTCACCCTCTCTCTCTC
CTCTCGCTCCTCACTCCCTTTCCCCTGCCCTCGCTCCTCGCTCCTTTTCCCCTCCTCTCGCTCGTCGCTCCCTTG
CCCCTCCTCTCCCCCTCCCCCTCCCCCTCCCCAGGAAAACCCCCCTCGAAGGATCCGAGTCCCAGGCTGAGGCAG
GATCACTCGTCTTTCTGCTAACACACGGTACGTCCTCTTCGTCCAGGATCCTTCATCGAGCGCAAACGGTGCGCG
CTCACGTGGCACTACCGGCTCGCGGACCCGGAGCTGGGACTGCACATGGCGCGCGAGTGCCAGAAAGAGCTCGAG
GCCGGGGTGGGACGGCGGTGGGAGGTGGAGGTGATGCCGGGCAAGGCCAACATCGAGGTGCGGCCGACCTTCATC
AACAAGGGCGAGATCGCCAAGCGGCTGGTGGCGACGTACCACAACCCGGAGGCGCAGCCGAGCGAGAGCGACCCG
AACCCCGGCAAGGTCGAGTTCGCGCTGTGCATGGGCGACGACTTCACGGACGAGGACATGTTCCGCAGCCTCAAC
GGGGCGTCCGGGGCGACGCTCAAGGCCGACCACGTCTTCACCGTGACGGTGGGGGCGAGCACCAAGGTGACGCTG
GCCAAGTGGCACCTGCTGGAGCCCGAGGACGTGATCGAGTGCGTGGCCCTGCTGGCGGTAGCCGAGGGCCCGCTG
GGCTCGGAGAAGATGGGCGAGGTCAACCTGGCGGCGCTGAGCACGGTCGAGGGACACATTCCGTCGGGCGAGACA
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail