Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10966
Gene name
LocationContig_935:9369..10687
Strand-
Gene length (bp)1318
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold 1.1E-42 268 375
PF15630 CENP-S CENP-S protein 1.2E-09 294 347
PF00125 Histone Core histone H2A/H2B/H3/H4 2.8E-06 254 344

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HGK9|YHLD_SCHPO Uncharacterized protein C800.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC800.13 PE=3 SV=1 259 366 2.0E-14
sp|F1NPG5|CENPT_CHICK Centromere protein T OS=Gallus gallus GN=CENPT PE=1 SV=2 273 380 4.0E-09
sp|Q96BT3|CENPT_HUMAN Centromere protein T OS=Homo sapiens GN=CENPT PE=1 SV=2 303 370 7.0E-08
sp|Q4R5U8|CENPT_MACFA Centromere protein T OS=Macaca fascicularis GN=CENPT PE=2 SV=1 303 370 8.0E-08
sp|Q561R1|CENPT_RAT Centromere protein T OS=Rattus norvegicus GN=Cenpt PE=1 SV=1 298 370 2.0E-07

GO

GO Term Description Terminal node
GO:0000786 nucleosome Yes
GO:0071821 FANCM-MHF complex Yes
GO:0003677 DNA binding Yes
GO:0005488 binding No
GO:0044446 intracellular organelle part No
GO:0005575 cellular_component No
GO:0044427 chromosomal part No
GO:0044428 nuclear part No
GO:0044422 organelle part No
GO:0003674 molecular_function No
GO:0044424 intracellular part No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0032991 protein-containing complex No
GO:0044464 cell part No
GO:0032993 protein-DNA complex No
GO:0044815 DNA packaging complex No
GO:0044451 nucleoplasm part No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10966
MEQRETPMAILRNLSRALAPASRPVAPSSSSPADGPSRVPGGDDDDDDDELPIDKPRLSLPLDHDDDDDDDDLQP
PRSAGLEEENFTVQSIELPRRALSEQPGLGLLRGSFGNERVSDFFEQYSNYPADDTARHSEFFPGLLEDIQARAA
AADFTLDRIDIDPARRATMGRDSDFGLQLPAGLDDQTTFLLSEPVADLGADSPVMDHSLADAAAPEGHDEPLARD
MEAADSSAEGDEGVNLTANQDAHNDASAKSARPRKRQKRLSKHGIEYPSLPPSFVKKVAQTALHSSGLSNPRISA
DTLAALTRASDWFFEQLGDDLGAFAKHAKRKTVEESDVVTLMRRQRQVGPDATIFSLAQRHLPRELLQELRMPVP
QASKKRRGKRPQGDGDEMELT*
Coding >Hirsu2|10966
ATGGAGCAGCGCGAGACCCCCATGGCCATCCTGCGCAACCTCAGCCGCGCCCTGGCCCCCGCCAGCCGGCCCGTC
GCGCCCTCGTCGTCGTCGCCCGCCGACGGGCCCTCCCGCGTCCCGGGGGGAGATGACGACGACGACGACGACGAG
CTGCCCATCGACAAGCCTCGGCTGTCGCTGCCCCTCGACCATGACGACGACGACGACGACGACGACCTGCAGCCG
CCGCGCTCCGCCGGCCTTGAAGAGGAGAATTTCACCGTTCAGTCGATTGAGCTGCCTAGACGTGCCTTGAGCGAG
CAGCCCGGCCTCGGCTTGCTGCGTGGCAGCTTCGGCAACGAGAGGGTCAGCGACTTCTTTGAACAATACAGCAAT
TATCCGGCCGACGACACAGCCCGCCATTCCGAATTTTTCCCCGGCCTTCTCGAGGACATTCAGGCCCGCGCAGCT
GCGGCCGATTTCACGCTGGACCGCATAGACATTGACCCGGCAAGGCGCGCAACCATGGGCCGCGACAGCGACTTC
GGCCTGCAGCTCCCGGCCGGCCTGGACGACCAAACTACCTTTTTACTGTCCGAGCCCGTTGCAGATCTGGGAGCC
GACTCTCCCGTGATGGACCACTCCTTGGCTGACGCTGCCGCCCCAGAGGGCCATGATGAACCACTGGCCCGCGAT
ATGGAGGCGGCTGACAGTTCGGCGGAAGGCGACGAAGGCGTGAACTTGACGGCAAATCAAGACGCGCACAACGAC
GCGTCGGCCAAATCCGCGAGGCCTCGGAAGCGCCAAAAGCGCCTGTCGAAGCATGGCATCGAGTATCCGTCGTTG
CCGCCCTCCTTCGTCAAAAAGGTCGCGCAGACGGCTCTCCACTCTTCCGGTCTCAGCAACCCCCGAATCTCGGCC
GATACTCTGGCCGCTCTGACGCGAGCATCGGACTGGTTCTTCGAGCAGCTGGGCGACGATTTGGGGGCCTTTGCC
AAGCACGCAAAGCGCAAGACGGTGGAAGAGAGCGATGTCGTGACTTTGATGCGTCGGCAGCGTCAGGTCGGGCCC
GATGCGACCATTTTCTCGTTGGCGCAACGACATCTGCCGCGAGAGCTGCTCCAGGAGCTGAGAATGCCCGTGCCC
CAGGCGAGCAAAAAACGCAGGGGCAAGCGTCCGCAGGGCGACGGAGATGAGATGGAGTTGACGTGA
Transcript >Hirsu2|10966
ATGGAGCAGCGCGAGACCCCCATGGCCATCCTGCGCAACCTCAGCCGCGCCCTGGCCCCCGCCAGCCGGCCCGTC
GCGCCCTCGTCGTCGTCGCCCGCCGACGGGCCCTCCCGCGTCCCGGGGGGAGATGACGACGACGACGACGACGAG
CTGCCCATCGACAAGCCTCGGCTGTCGCTGCCCCTCGACCATGACGACGACGACGACGACGACGACCTGCAGCCG
CCGCGCTCCGCCGGCCTTGAAGAGGAGAATTTCACCGTTCAGTCGATTGAGCTGCCTAGACGTGCCTTGAGCGAG
CAGCCCGGCCTCGGCTTGCTGCGTGGCAGCTTCGGCAACGAGAGGGTCAGCGACTTCTTTGAACAATACAGCAAT
TATCCGGCCGACGACACAGCCCGCCATTCCGAATTTTTCCCCGGCCTTCTCGAGGACATTCAGGCCCGCGCAGCT
GCGGCCGATTTCACGCTGGACCGCATAGACATTGACCCGGCAAGGCGCGCAACCATGGGCCGCGACAGCGACTTC
GGCCTGCAGCTCCCGGCCGGCCTGGACGACCAAACTACCTTTTTACTGTCCGAGCCCGTTGCAGATCTGGGAGCC
GACTCTCCCGTGATGGACCACTCCTTGGCTGACGCTGCCGCCCCAGAGGGCCATGATGAACCACTGGCCCGCGAT
ATGGAGGCGGCTGACAGTTCGGCGGAAGGCGACGAAGGCGTGAACTTGACGGCAAATCAAGACGCGCACAACGAC
GCGTCGGCCAAATCCGCGAGGCCTCGGAAGCGCCAAAAGCGCCTGTCGAAGCATGGCATCGAGTATCCGTCGTTG
CCGCCCTCCTTCGTCAAAAAGGTCGCGCAGACGGCTCTCCACTCTTCCGGTCTCAGCAACCCCCGAATCTCGGCC
GATACTCTGGCCGCTCTGACGCGAGCATCGGACTGGTTCTTCGAGCAGCTGGGCGACGATTTGGGGGCCTTTGCC
AAGCACGCAAAGCGCAAGACGGTGGAAGAGAGCGATGTCGTGACTTTGATGCGTCGGCAGCGTCAGGTCGGGCCC
GATGCGACCATTTTCTCGTTGGCGCAACGACATCTGCCGCGAGAGCTGCTCCAGGAGCTGAGAATGCCCGTGCCC
CAGGCGAGCAAAAAACGCAGGGGCAAGCGTCCGCAGGGCGACGGAGATGAGATGGAGTTGACGTGA
Gene >Hirsu2|10966
ATGGAGCAGCGCGAGACCCCCATGGCCATCCTGCGCAACCTCAGCCGCGCCCTGGCCCCCGCCAGCCGGCCCGTC
GCGCCCTCGTCGTCGTCGCCCGCCGACGGGCCCTCCCGCGTCCCGGGGGGAGATGACGACGACGACGACGACGAG
CTGCCCATCGACAAGCCTCGGCTGTCGCTGCCCCTCGACCATGACGACGACGACGACGACGACGACCTGCAGCCG
CCGCGCTCCGCCGGCCTTGAAGAGGAGAATTTCACCGTTCAGTCGATTGAGCTGCCTAGACGTGCCTTGAGCGAG
CAGCCCGGCCTCGGCTTGCTGCGTGGCAGCTTCGGCAACGAGAGGGTCAGCGACTTCTTTGAACAATACAGCAAT
TATCCGGCCGACGACACAGCCCGCCATTCCGAATTTTTCCCCGGCCTTCTCGAGGACATTCAGGCCCGCGCAGCT
GCGGCCGATTTCACGCTGGACCGGTAGGTGCCATGCCTTGTCCCGTCGCCATCTTTCCTATCTACCGCTCTCCTG
ACCGCTTTTCTAGCATAGACATTGACCCGGCAAGGCGCGCAACCATGGGCCGCGACAGCGACTTCGGCCTGCAGC
TCCCGGCCGGCCTGGACGACCAAACTACCTTTTTACTGTCCGAGCCCGTTGCAGATCTGGGAGCCGACTCTCCCG
TGATGGACCACTCCTTGGCTGACGCTGCCGCCCCAGAGGGCCATGATGAACCACTGGCCCGCGATATGGAGGCGG
CTGACAGTTCGGCGGAAGGCGACGAAGGCGTGAACTTGACGGCAAATCAAGACGCGCACAACGACGCGTCGGCCA
AATCCGCGAGGCCTCGGAAGCGCCAAAAGCGCCTGTCGAAGCATGGCATCGAGTATCCGTCGTTGCCGCCCTCCT
TCGTCAAAAAGGTCGCGCAGACGGCTCTCCACTCTTCCGGTCTCAGCAACCCCCGAATCTCGGCCGATACTCTGG
CCGCTCTGACGCGAGCATCGGACTGGTTCTTCGAGCAGCTGGGCGACGATTTGGGGGCCTTTGCCAAGCACGCAA
AGCGCAAGACGGTGGAAGAGAGCGATGTCGTGACTTTGATGCGTCGGTCAGTTGCTGCGCATTCACTCCCCGTTT
CCCTGTCTCTGCTCAGACGCTAATATCGCGCAGGCAGCGTCAGGTCGGGCCCGATGCGACCATTTTCTCGTTGGC
GCAACGACATCTGCCGCGAGAGCTGCTCCAGGAGCTGAGAATGCCCGTGCCCCAGGCGAGCAAAAAACGCAGGGG
CAAGCGTCCGCAGGGCGACGGAGATGAGATGGAGTTGACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail