Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10965
Gene name
LocationContig_935:8235..9348
Strand+
Gene length (bp)1113
Transcript length (bp)741
Coding sequence length (bp)741
Protein length (aa) 247

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02104 SURF1 SURF1 family 4.6E-49 11 219

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y810|SHY1_SCHPO Cytochrome oxidase assembly protein shy1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shy1 PE=3 SV=1 7 231 8.0E-61
sp|P09925|SURF1_MOUSE Surfeit locus protein 1 OS=Mus musculus GN=Surf1 PE=1 SV=3 7 234 1.0E-47
sp|Q15526|SURF1_HUMAN Surfeit locus protein 1 OS=Homo sapiens GN=SURF1 PE=1 SV=1 7 236 8.0E-46
sp|Q9QXU2|SURF1_RAT Surfeit locus protein 1 OS=Rattus norvegicus GN=Surf1 PE=2 SV=1 7 236 1.0E-45
sp|A4IHH4|SURF1_XENTR Surfeit locus protein 1 OS=Xenopus tropicalis GN=surf1 PE=2 SV=1 7 231 1.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y810|SHY1_SCHPO Cytochrome oxidase assembly protein shy1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shy1 PE=3 SV=1 7 231 8.0E-61
sp|P09925|SURF1_MOUSE Surfeit locus protein 1 OS=Mus musculus GN=Surf1 PE=1 SV=3 7 234 1.0E-47
sp|Q15526|SURF1_HUMAN Surfeit locus protein 1 OS=Homo sapiens GN=SURF1 PE=1 SV=1 7 236 8.0E-46
sp|Q9QXU2|SURF1_RAT Surfeit locus protein 1 OS=Rattus norvegicus GN=Surf1 PE=2 SV=1 7 236 1.0E-45
sp|A4IHH4|SURF1_XENTR Surfeit locus protein 1 OS=Xenopus tropicalis GN=surf1 PE=2 SV=1 7 231 1.0E-43
sp|Q800L1|SURF1_CHICK Surfeit locus protein 1 OS=Gallus gallus GN=SURF1 PE=3 SV=1 8 226 6.0E-43
sp|O57593|SURF1_TAKRU Surfeit locus protein 1 (Fragment) OS=Takifugu rubripes GN=surf1 PE=3 SV=1 7 226 2.0E-42
sp|Q9U4F3|SURF1_DROME SURF1-like protein OS=Drosophila melanogaster GN=Surf1 PE=2 SV=1 7 234 4.0E-42
sp|A8Y2C9|SURF1_CAEBR SURF1-like protein OS=Caenorhabditis briggsae GN=sft-1 PE=3 SV=1 6 224 3.0E-39
sp|A9UWF0|SURF1_MONBE SURF1-like protein OS=Monosiga brevicollis GN=18583 PE=3 SV=1 8 231 2.0E-38
sp|Q9N5N8|SURF1_CAEEL SURF1-like protein OS=Caenorhabditis elegans GN=sft-1 PE=3 SV=1 6 224 2.0E-37
sp|P53266|SHY1_YEAST Cytochrome oxidase assembly protein SHY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHY1 PE=1 SV=1 7 176 1.0E-33
sp|Q556J9|SURF1_DICDI SURF1-like protein OS=Dictyostelium discoideum GN=surf1-1 PE=3 SV=2 7 231 8.0E-33
sp|Q9SE51|SURF1_ARATH Surfeit locus protein 1 OS=Arabidopsis thaliana GN=SURF1 PE=2 SV=1 6 230 4.0E-18
sp|Q1RJM4|SURF1_RICBR SURF1-like protein OS=Rickettsia bellii (strain RML369-C) GN=RBE_0359 PE=3 SV=1 7 235 9.0E-16
sp|Q4UN32|SURF1_RICFE SURF1-like protein OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0175 PE=3 SV=1 7 236 4.0E-15
sp|Q92GL0|SURF1_RICCN SURF1-like protein OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1113 PE=3 SV=1 7 231 7.0E-13
sp|Q9ZCJ8|SURF1_RICPR SURF1-like protein OS=Rickettsia prowazekii (strain Madrid E) GN=RP733 PE=3 SV=1 2 224 3.0E-09
sp|P66884|Y2259_MYCBO Uncharacterized SURF1-like protein Mb2259 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2259 PE=3 SV=1 18 193 8.0E-06
sp|P9WGA7|Y2235_MYCTU Uncharacterized SURF1-like protein Rv2235 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2235 PE=1 SV=1 18 193 8.0E-06
sp|P9WGA6|Y2235_MYCTO Uncharacterized SURF1-like protein MT2294 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2294 PE=3 SV=1 18 193 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 5 24 19
2 210 229 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10965
MIRRIILLVLIPVTAFALGTWQVQRLSWKTELLAKLEDRLVRDPLPLPPHIDPTVVHEFDYRRVLATGRFRHDQE
MLIGPRMRDGQDGYMVVTPLERDDASTILVNRGWISKKHRSQKTRPDSLPRGQVTVEGLLRKPWKKNMFTPHNRP
DKGEFYFPDVEQMAALTGSQPVWIEATMEPEYMRMVDYEARGIPFGRPAEVNVRNNHAQYIFTWYSLCVATSVML
YLVLKKPTPNIARRVQAGRDL*
Coding >Hirsu2|10965
ATGATCCGGAGAATCATCCTGCTAGTCCTCATCCCCGTAACGGCATTCGCGCTCGGCACTTGGCAGGTCCAGCGA
CTGAGCTGGAAGACGGAACTGCTCGCAAAGTTGGAGGACCGCCTCGTGCGCGACCCTCTGCCCCTGCCGCCGCAC
ATCGACCCGACCGTCGTCCATGAGTTCGACTACCGACGGGTTCTGGCCACGGGCCGCTTCCGCCACGACCAGGAG
ATGCTCATTGGACCGCGCATGCGCGACGGCCAGGACGGCTACATGGTGGTGACGCCGCTTGAGCGCGACGACGCG
TCCACCATCCTCGTCAACAGGGGCTGGATCAGCAAGAAGCACCGCAGCCAAAAGACGCGCCCGGACTCCCTGCCG
CGGGGCCAAGTCACGGTCGAGGGGCTGCTGCGCAAGCCTTGGAAGAAGAACATGTTCACGCCGCACAACAGGCCC
GACAAGGGAGAGTTCTACTTCCCCGACGTGGAGCAGATGGCGGCGCTGACCGGCAGTCAGCCGGTCTGGATTGAA
GCTACCATGGAGCCCGAGTACATGAGAATGGTCGACTACGAGGCCCGTGGCATCCCCTTCGGACGGCCCGCCGAA
GTCAACGTGAGGAACAACCACGCCCAGTACATCTTTACCTGGTACAGCTTGTGCGTCGCCACATCAGTCATGCTA
TACTTGGTCCTCAAGAAACCGACGCCCAACATCGCCCGTCGCGTGCAAGCGGGCCGGGACTTGTAA
Transcript >Hirsu2|10965
ATGATCCGGAGAATCATCCTGCTAGTCCTCATCCCCGTAACGGCATTCGCGCTCGGCACTTGGCAGGTCCAGCGA
CTGAGCTGGAAGACGGAACTGCTCGCAAAGTTGGAGGACCGCCTCGTGCGCGACCCTCTGCCCCTGCCGCCGCAC
ATCGACCCGACCGTCGTCCATGAGTTCGACTACCGACGGGTTCTGGCCACGGGCCGCTTCCGCCACGACCAGGAG
ATGCTCATTGGACCGCGCATGCGCGACGGCCAGGACGGCTACATGGTGGTGACGCCGCTTGAGCGCGACGACGCG
TCCACCATCCTCGTCAACAGGGGCTGGATCAGCAAGAAGCACCGCAGCCAAAAGACGCGCCCGGACTCCCTGCCG
CGGGGCCAAGTCACGGTCGAGGGGCTGCTGCGCAAGCCTTGGAAGAAGAACATGTTCACGCCGCACAACAGGCCC
GACAAGGGAGAGTTCTACTTCCCCGACGTGGAGCAGATGGCGGCGCTGACCGGCAGTCAGCCGGTCTGGATTGAA
GCTACCATGGAGCCCGAGTACATGAGAATGGTCGACTACGAGGCCCGTGGCATCCCCTTCGGACGGCCCGCCGAA
GTCAACGTGAGGAACAACCACGCCCAGTACATCTTTACCTGGTACAGCTTGTGCGTCGCCACATCAGTCATGCTA
TACTTGGTCCTCAAGAAACCGACGCCCAACATCGCCCGTCGCGTGCAAGCGGGCCGGGACTTGTAA
Gene >Hirsu2|10965
ATGATCCGGAGTTCGTTTCCATCCTTGATGCGCCTCCTCAAATTGTCCGTGCCGGTCGGAGACACGGTCCAGGAA
TCATCCTGCTAGGTTCGTCGCACATCACCCACATTTGCGTCTGCCTTCCATCCGCCAGCACAGCTTGACGTCCGC
CAGCCACGCGGCACTGTTCTCCATTCTTCTTGACGATGAAATGAAATGAAAAATTTCACCCCCGTCTCCTGACCT
GCCGTCTTTCCCGCAGTCCTCATCCCCGTAACGGCATTCGCGCTCGGCACTTGGCAGGTCCAGCGACTGAGCTGG
AAGACGGAACTGCTCGCAAAGTTGGAGGACCGCCTCGTGCGCGACCCTCTGCCCCTGCCGCCGCACATCGACCCG
ACCGTCGTCCATGAGTTCGACTACCGACGGGTTCTGGCCACGGGCCGCTTCCGCCACGACCAGGAGATGCTCATT
GGACCGCGCATGCGCGACGGCCAGGACGGCTACATGGTGGTGACGCCGCTTGAGCGCGACGACGCGTCCACCATC
CTCGTCAACAGGGGCTGGATCAGCAAGAAGCACCGCAGCCAAAAGACGCGCCCGGACTCCCTGCCGCGGGGCCAA
GTCACGGTCGAGGGGCTGCTGCGCAAGCCTTGGAAGAAGAACATGTTCACGCCGCACAACAGGCCCGACAAGGGA
GAGTTCTACTTCCCCGACGTGGAGCAGATGGCGGCGCTGACCGGCAGTCAGCCGGTCTGGATTGAAGCTACCATG
GGTATGTGCCCCCGTCAGACCCACGGCTTGCTCGTCCCGTGAGCTAAGTCGACAGCAGAGCCCGAGTACATGAGA
ATGGTCGACTACGAGGCCCGTGGCATCCCCTTCGGACGGCCCGCCGAAGTCAACGTGAGGAACAACCACGCCCAG
TACATCTTTACCTGGTGTGTTCCCGTGCCGCCCCCGTCGTCCTCCCCCCCTCCTCCCCAAACGTCTCCCTCTCAT
ATGTCCACCTGCGGCATCTGGCTTACGCTGCCCTCAAGGTACAGCTTGTGCGTCGCCACATCAGTCATGCTATAC
TTGGTCCTCAAGAAACCGACGCCCAACATCGCCCGTCGCGTGCAAGCGGGCCGGGACTTGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail