Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10964
Gene name
LocationContig_935:5858..7452
Strand-
Gene length (bp)1594
Transcript length (bp)1383
Coding sequence length (bp)1383
Protein length (aa) 461

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00789 UBX UBX domain 7.3E-15 283 361

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34631|UBXN4_CAEEL UBX domain-containing protein 4 OS=Caenorhabditis elegans GN=ubxn-4 PE=3 SV=1 2 451 2.0E-20
sp|P38349|UBX7_YEAST UBX domain-containing protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX7 PE=1 SV=1 220 391 3.0E-16
sp|Q9ZW74|PUX11_ARATH Plant UBX domain-containing protein 11 OS=Arabidopsis thaliana GN=PUX11 PE=1 SV=2 1 363 1.0E-13
sp|Q3ZBU9|UBXN4_BOVIN UBX domain-containing protein 4 OS=Bos taurus GN=UBXN4 PE=2 SV=2 1 397 2.0E-11
sp|Q5HZY0|UBXN4_RAT UBX domain-containing protein 4 OS=Rattus norvegicus GN=Ubxn4 PE=1 SV=1 1 397 6.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34631|UBXN4_CAEEL UBX domain-containing protein 4 OS=Caenorhabditis elegans GN=ubxn-4 PE=3 SV=1 2 451 2.0E-20
sp|P38349|UBX7_YEAST UBX domain-containing protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX7 PE=1 SV=1 220 391 3.0E-16
sp|Q9ZW74|PUX11_ARATH Plant UBX domain-containing protein 11 OS=Arabidopsis thaliana GN=PUX11 PE=1 SV=2 1 363 1.0E-13
sp|Q3ZBU9|UBXN4_BOVIN UBX domain-containing protein 4 OS=Bos taurus GN=UBXN4 PE=2 SV=2 1 397 2.0E-11
sp|Q5HZY0|UBXN4_RAT UBX domain-containing protein 4 OS=Rattus norvegicus GN=Ubxn4 PE=1 SV=1 1 397 6.0E-11
sp|Q92575|UBXN4_HUMAN UBX domain-containing protein 4 OS=Homo sapiens GN=UBXN4 PE=1 SV=2 1 397 2.0E-10
sp|Q8VCH8|UBXN4_MOUSE UBX domain-containing protein 4 OS=Mus musculus GN=Ubxn4 PE=1 SV=1 1 397 2.0E-10
sp|Q5R4I3|UBXN4_PONAB UBX domain-containing protein 4 OS=Pongo abelii GN=UBXN4 PE=2 SV=1 1 397 5.0E-10
sp|Q6NXA9|UBXN1_DANRE UBX domain-containing protein 1 OS=Danio rerio GN=ubxn1 PE=2 SV=1 219 361 2.0E-09
sp|P47049|UBX6_YEAST UBX domain-containing protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX6 PE=1 SV=1 219 390 7.0E-09
sp|Q499N6|UBXN1_RAT UBX domain-containing protein 1 OS=Rattus norvegicus GN=Ubxn1 PE=3 SV=2 229 361 1.0E-08
sp|Q6GL77|UBXN1_XENTR UBX domain-containing protein 1 OS=Xenopus tropicalis GN=ubxn1 PE=2 SV=1 219 361 2.0E-08
sp|Q6IP50|UBX1A_XENLA UBX domain-containing protein 1-A OS=Xenopus laevis GN=ubxn1-a PE=2 SV=1 212 361 3.0E-08
sp|Q922Y1|UBXN1_MOUSE UBX domain-containing protein 1 OS=Mus musculus GN=Ubxn1 PE=1 SV=1 229 361 3.0E-08
sp|Q32KW2|UBXN1_BOVIN UBX domain-containing protein 1 OS=Bos taurus GN=UBXN1 PE=2 SV=1 229 361 4.0E-08
sp|Q6GLV4|UBX1B_XENLA UBX domain-containing protein 1-B OS=Xenopus laevis GN=ubxn1-b PE=2 SV=1 212 361 5.0E-08
sp|Q04323|UBXN1_HUMAN UBX domain-containing protein 1 OS=Homo sapiens GN=UBXN1 PE=1 SV=2 229 361 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum 0.3462 0.2178 0.031 0.1245 0.5179 0.0295 0.847 0.3538 0.5155 0.1803

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1439
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3996
Ophiocordyceps australis map64 (Brazil) OphauB2|7460
Ophiocordyceps camponoti-floridani Ophcf2|06244
Ophiocordyceps camponoti-rufipedis Ophun1|7465
Ophiocordyceps kimflemingae Ophio5|3270
Ophiocordyceps subramaniannii Hirsu2|10964 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10964
MFYQGSLQEGISTAVGQQKMVLCFVTNESEESQKWEDEFLQDSSLKELIRDQAVALRLEAGSESAGYLAQIFPLP
KTPTIVIMKHGELKEYIASGTGKDDFLRRVQTAFNAAPPPPTPARAVEPSSSSASPSLLSTSATSAAEQPSSNPS
TSTSPETERSDSVRRILAERAASLQAKKDEAERRAKEERSKAKDKAKAEADAGADTEAARSHRQAELLRKKRQQE
SEERRRILKRIEDDRAERRQRAAEREQRRIEGLKTGDVAASLVSAPESRLPSTTRIGDMASIQVRLFDGSTMRSR
FKTAAPFRDVRAWVDENRTDGHEPYTFRQLLTPLPNKAIDETEEGRALGELGLAPSSTLILIPVQNFSSAYEAGP
QGLFSRLVAALLAMFHWLAGLVGLGRATVDATAPAAAAPEGSSPTAQARDRRIRGFENPEDRRRDHQLYNGNSLN
FEPRPDEDDA*
Coding >Hirsu2|10964
ATGTTCTATCAGGGATCCTTGCAGGAGGGAATCTCCACGGCCGTGGGGCAGCAGAAGATGGTATTGTGTTTCGTG
ACGAACGAGAGCGAAGAGAGCCAGAAGTGGGAAGATGAGTTTCTGCAGGACAGTTCTCTGAAGGAGTTGATACGC
GACCAGGCTGTCGCTCTGCGCCTCGAGGCCGGCTCCGAGTCGGCCGGCTACCTCGCCCAGATCTTCCCCCTGCCC
AAGACGCCCACCATCGTCATCATGAAGCACGGCGAGCTGAAGGAGTACATTGCCTCGGGCACCGGCAAGGACGAC
TTCCTGCGCCGCGTTCAGACGGCCTTCAACGCCGCGCCACCTCCGCCCACGCCTGCGCGGGCCGTCGAGCCGTCC
TCCTCATCAGCATCACCGTCCCTGCTCTCCACCAGCGCAACATCGGCGGCGGAGCAGCCGTCGTCGAACCCGTCG
ACCTCGACCTCGCCCGAGACGGAGAGGTCCGACAGCGTCCGCCGCATCCTGGCCGAGAGAGCAGCCAGCCTCCAG
GCGAAGAAGGATGAGGCCGAGCGCAGGGCCAAGGAAGAGCGGTCCAAGGCCAAGGACAAGGCCAAGGCCGAGGCC
GACGCGGGAGCCGACACCGAGGCCGCCCGGTCGCACCGGCAGGCGGAGCTGCTCCGGAAGAAGAGGCAGCAGGAG
TCGGAGGAGCGCCGACGGATTCTGAAGCGCATCGAGGACGACAGGGCGGAGCGGCGCCAGCGCGCGGCCGAGCGG
GAGCAGCGGCGGATCGAAGGCCTCAAGACGGGCGACGTGGCTGCCTCGCTCGTCAGCGCGCCCGAGTCGAGGCTG
CCGTCGACGACGCGCATCGGCGACATGGCCTCGATCCAAGTGAGGCTGTTCGACGGCTCGACGATGCGCTCCCGC
TTCAAGACGGCGGCCCCCTTCCGGGACGTGCGCGCGTGGGTCGACGAGAACCGCACGGACGGCCACGAGCCCTAC
ACCTTTCGGCAGCTGCTGACGCCCCTGCCCAACAAGGCCATCGACGAGACGGAGGAGGGCCGCGCCCTGGGGGAG
CTGGGCCTGGCGCCCTCGTCGACCCTGATCCTCATCCCCGTGCAGAACTTTTCGTCGGCGTACGAGGCCGGGCCG
CAGGGCCTGTTCTCGCGTCTCGTCGCCGCCCTGCTGGCCATGTTCCACTGGCTGGCGGGGCTGGTCGGCCTCGGA
CGCGCGACGGTAGACGCTACGGCCCCGGCGGCCGCGGCCCCGGAAGGGTCGTCGCCGACGGCGCAGGCGAGGGAT
CGCCGGATCAGGGGCTTCGAGAACCCCGAGGACCGGCGGAGAGATCACCAGCTCTACAACGGAAATTCTTTAAAT
TTTGAGCCCCGGCCGGACGAGGACGACGCGTGA
Transcript >Hirsu2|10964
ATGTTCTATCAGGGATCCTTGCAGGAGGGAATCTCCACGGCCGTGGGGCAGCAGAAGATGGTATTGTGTTTCGTG
ACGAACGAGAGCGAAGAGAGCCAGAAGTGGGAAGATGAGTTTCTGCAGGACAGTTCTCTGAAGGAGTTGATACGC
GACCAGGCTGTCGCTCTGCGCCTCGAGGCCGGCTCCGAGTCGGCCGGCTACCTCGCCCAGATCTTCCCCCTGCCC
AAGACGCCCACCATCGTCATCATGAAGCACGGCGAGCTGAAGGAGTACATTGCCTCGGGCACCGGCAAGGACGAC
TTCCTGCGCCGCGTTCAGACGGCCTTCAACGCCGCGCCACCTCCGCCCACGCCTGCGCGGGCCGTCGAGCCGTCC
TCCTCATCAGCATCACCGTCCCTGCTCTCCACCAGCGCAACATCGGCGGCGGAGCAGCCGTCGTCGAACCCGTCG
ACCTCGACCTCGCCCGAGACGGAGAGGTCCGACAGCGTCCGCCGCATCCTGGCCGAGAGAGCAGCCAGCCTCCAG
GCGAAGAAGGATGAGGCCGAGCGCAGGGCCAAGGAAGAGCGGTCCAAGGCCAAGGACAAGGCCAAGGCCGAGGCC
GACGCGGGAGCCGACACCGAGGCCGCCCGGTCGCACCGGCAGGCGGAGCTGCTCCGGAAGAAGAGGCAGCAGGAG
TCGGAGGAGCGCCGACGGATTCTGAAGCGCATCGAGGACGACAGGGCGGAGCGGCGCCAGCGCGCGGCCGAGCGG
GAGCAGCGGCGGATCGAAGGCCTCAAGACGGGCGACGTGGCTGCCTCGCTCGTCAGCGCGCCCGAGTCGAGGCTG
CCGTCGACGACGCGCATCGGCGACATGGCCTCGATCCAAGTGAGGCTGTTCGACGGCTCGACGATGCGCTCCCGC
TTCAAGACGGCGGCCCCCTTCCGGGACGTGCGCGCGTGGGTCGACGAGAACCGCACGGACGGCCACGAGCCCTAC
ACCTTTCGGCAGCTGCTGACGCCCCTGCCCAACAAGGCCATCGACGAGACGGAGGAGGGCCGCGCCCTGGGGGAG
CTGGGCCTGGCGCCCTCGTCGACCCTGATCCTCATCCCCGTGCAGAACTTTTCGTCGGCGTACGAGGCCGGGCCG
CAGGGCCTGTTCTCGCGTCTCGTCGCCGCCCTGCTGGCCATGTTCCACTGGCTGGCGGGGCTGGTCGGCCTCGGA
CGCGCGACGGTAGACGCTACGGCCCCGGCGGCCGCGGCCCCGGAAGGGTCGTCGCCGACGGCGCAGGCGAGGGAT
CGCCGGATCAGGGGCTTCGAGAACCCCGAGGACCGGCGGAGAGATCACCAGCTCTACAACGGAAATTCTTTAAAT
TTTGAGCCCCGGCCGGACGAGGACGACGCGTGA
Gene >Hirsu2|10964
ATGTTCTATCAGGGATCCTTGCAGGAGGGAATCTCCACGGCCGTGGGGCAGCAGAAGATGGTATTGTGTTTCGTG
ACGAGCAAGTAGCATAGCCCGCTGACGCCGCCTGGCCGACTGTTCACTAACATGGCGCCTCATTTCCAGACGAGA
GCGAAGAGAGCCAGAAGTGGGAAGATGAGTTTCTGCAGGACAGTTCTGTACGCCGCGCCCGCCTGGCTTCAACCG
GTGGCTCGATGCTAACCCGAATCGCTCTGTCTAGCTGAAGGAGTTGATACGCGACCAGGCTGTCGCTCTGCGCCT
CGAGGCCGGCTCCGAGTCGGCCGGCTACCTCGCCCAGATCTTCCCCCTGCCCAAGACGCCCACCATCGTCATCAT
GAAGCACGGCGAGCTGAAGGAGTACATTGCCTCGGGCACCGGCAAGGACGACTTCCTGCGCCGCGTTCAGACGGC
CTTCAACGCCGCGCCACCTCCGCCCACGCCTGCGCGGGCCGTCGAGCCGTCCTCCTCATCAGCATCACCGTCCCT
GCTCTCCACCAGCGCAACATCGGCGGCGGAGCAGCCGTCGTCGAACCCGTCGACCTCGACCTCGCCCGAGACGGA
GAGGTCCGACAGCGTCCGCCGCATCCTGGCCGAGAGAGCAGCCAGCCTCCAGGCGAAGAAGGATGAGGCCGAGCG
CAGGGCCAAGGAAGAGCGGTCCAAGGCCAAGGACAAGGCCAAGGCCGAGGCCGACGCGGGAGCCGACACCGAGGC
CGCCCGGTCGCACCGGCAGGCGGAGCTGCTCCGGAAGAAGAGGCAGCAGGAGTCGGAGGAGCGCCGACGGATTCT
GAAGCGCATCGAGGACGACAGGGCGGAGCGGCGCCAGCGCGCGGCCGAGCGGGAGCAGCGGCGGATCGAAGGCCT
CAAGACGGGCGACGTGGCTGCCTCGCTCGTCAGCGCGCCCGAGTCGAGGCTGCCGTCGACGACGCGCATCGGCGA
CATGGCCTCGATCCAAGTGAGGCTGTTCGACGGCTCGACGATGCGCTCCCGCTTCAAGACGGCGGCCCCCTTCCG
GGACGTGCGCGCGTGGGTCGACGAGAACCGCACGGACGGCCACGAGCCCTACACCTTTCGGCAGCTGCTGACGCC
CCTGCCCAACAAGGCCATCGACGAGACGGAGGAGGGCCGCGCCCTGGGGGAGCTGGGCCTGGCGCCCTCGTCGAC
CCTGATCCTCATCCCCGTGCAGAACTTTTCGTCGGCGTACGAGGCCGGGCCGCAGGGCCTGTTCTCGCGTCTCGT
CGCCGCCCTGCTGGCCATGTTCCACTGGCTGGCGGGGCTGGTCGGCCTCGGACGCGCGACGGTAGACGCTACGGC
CCCGGCGGCCGCGGCCCCGGAAGGGTCGTCGCCGACGGCGCAGGCGAGGGATCGCCGGATCAGGGGCTTCGAGAA
CCCCGAGGACCGGCGGAGAGATCACCAGCTCTACAACGGAAATTCTGTGAGTCTACGCGTTCCATGCATCATGTC
CAAATGTACACGCATCCGAGAGCCGACAGACAAAGACACTGACTCGCTCGTCAAGTTAAATTTTGAGCCCCGGCC
GGACGAGGACGACGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail