Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10962
Gene name
LocationContig_935:1208..3570
Strand+
Gene length (bp)2362
Transcript length (bp)2295
Coding sequence length (bp)2295
Protein length (aa) 765

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04515 Choline_transpo Plasma-membrane choline transporter 8.5E-30 412 735

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74441|CTL1_SCHPO Choline transporter-like protein ctl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctl1 PE=1 SV=1 302 753 8.0E-40

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 295 317 22
2 337 359 22
3 366 388 22
4 403 422 19
5 449 471 22
6 491 513 22
7 658 680 22
8 708 730 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10962
MFSEYASRFLAQSQSRLSNLGQPDSDHPPRSTDWPASRPGRHPRDAGRGAANAPPARSFLARGYAGSPYQQNGAG
SRFGHLGFASRISAAQDAPLFHSTLDEFREEDDEGEREREAADLFALQRSRRVAAASKLAESTESANSRTSVDES
AGDIENPYRGHGLGRGIRSSWNGTRSTHQPRPAQDEALFEEEAEEVPQPRGDRSDTGKGKMVDIGLESQVDGDEG
PPGSLLAGEGPADASPPPFQQFSPGAEREPFILKRTSTSDSVLSSLQRQDAAESEPAQALGEGELFKHDPFFAWI
FLISLAGMMSTFTLVWLHTSPRKSPVGDTIYTTLQRSFDMLAVDTVVSVFVSLVWLAALRSFVRPLVSVILVAVP
VIMLSFSLYSFVSSFQGRTHGSSLQDSVMRWASLVPAAACLLWLWLVVKGRRAIQQAIEILQFSSKILAQNPGLL
LVGFGCLALIVLWTWAWLAMFTRVFMGGYFSKSLVRFVIRVSSWWLGAAFILMYLWTLAVINAVHRATTAATVSQ
WYFHRNAGPATPSREIVAAALGHATTTIFGSICQSTLMSLMLRAPLLFLPRRIGLGLTNLAAFWVPTPIIALTNP
LTVTYSAIHSQCLATSARGLDQMEVVSPAMPTTTLTPRALRLRGQPNHGLLPYRLAKLLLVATRFIMATGLGFAG
WVITAKQLQIQLPDGVGVRGSAYAYVVGLMASFIGYSVMGAMEGILSGIVDAVLICYGSERRMERGHGRFCLEAA
YLFGERRIGDEAYA*
Coding >Hirsu2|10962
ATGTTTTCGGAGTATGCTTCCCGCTTTCTAGCCCAGTCCCAGTCCCGGCTGTCCAACTTGGGCCAGCCCGACTCC
GACCATCCGCCGCGATCGACCGACTGGCCGGCCTCGCGTCCGGGCCGCCACCCGCGAGACGCCGGCCGCGGCGCC
GCCAACGCGCCGCCCGCCAGGTCCTTCCTCGCCCGCGGCTACGCCGGGAGCCCGTACCAGCAGAACGGCGCCGGC
TCGCGCTTCGGCCACCTGGGCTTCGCCTCCCGCATATCGGCCGCCCAGGACGCGCCCCTCTTCCACAGCACCCTC
GACGAGTTCCGCGAAGAGGACGACGAGGGCGAGCGGGAGAGGGAGGCGGCCGACCTGTTCGCGCTGCAGCGGTCG
CGCCGCGTCGCCGCCGCCAGCAAGCTGGCCGAGAGCACCGAGTCGGCCAACAGCCGCACCTCGGTCGACGAGAGC
GCGGGCGACATCGAGAACCCGTACCGCGGCCACGGCCTGGGGCGCGGCATCCGGAGCAGCTGGAACGGCACGAGG
AGCACGCACCAGCCCCGCCCGGCCCAGGATGAGGCCCTGTTCGAGGAGGAGGCCGAGGAGGTGCCGCAGCCGCGG
GGCGATCGATCGGATACCGGCAAGGGCAAGATGGTCGACATCGGCCTGGAATCGCAGGTAGACGGCGACGAGGGC
CCGCCCGGGTCGCTCCTGGCCGGGGAGGGGCCCGCCGACGCGAGCCCCCCCCCCTTCCAGCAGTTCAGCCCGGGC
GCCGAGCGGGAGCCCTTCATCCTCAAGCGGACGTCGACGAGCGACTCGGTCCTGAGCAGCCTGCAGCGCCAGGAC
GCGGCCGAGAGCGAGCCGGCGCAGGCCCTGGGCGAGGGCGAGCTGTTCAAGCACGACCCCTTCTTCGCCTGGATC
TTCCTCATCAGCCTGGCCGGCATGATGTCGACCTTCACCCTCGTCTGGCTGCACACGTCGCCGCGGAAGAGCCCG
GTCGGCGACACCATCTACACGACGCTGCAGCGGTCGTTCGACATGCTGGCCGTCGACACCGTCGTCTCCGTCTTC
GTCTCGCTCGTCTGGCTGGCCGCGCTGCGCTCCTTCGTCCGGCCGCTCGTCAGCGTCATCCTGGTGGCCGTGCCC
GTCATCATGCTCTCCTTCTCCCTCTACTCCTTCGTCTCCTCCTTCCAGGGCCGGACGCACGGGTCCAGCCTGCAG
GACAGCGTGATGCGGTGGGCCTCGCTCGTCCCGGCCGCCGCCTGCCTGCTCTGGCTGTGGCTCGTCGTCAAGGGG
CGGCGGGCGATCCAGCAGGCCATCGAGATCCTGCAGTTCTCGTCCAAGATCCTGGCGCAGAACCCGGGCCTCCTG
CTCGTCGGCTTCGGCTGCCTGGCCCTCATCGTGCTCTGGACGTGGGCCTGGCTGGCCATGTTCACGCGCGTCTTC
ATGGGCGGCTACTTCTCCAAGTCGCTGGTCCGCTTCGTCATCCGCGTCTCGAGCTGGTGGCTGGGCGCGGCCTTC
ATCCTCATGTACCTGTGGACGCTGGCCGTCATCAACGCCGTGCACCGGGCGACGACGGCGGCGACGGTGTCGCAG
TGGTACTTTCACCGCAACGCCGGGCCGGCCACGCCGTCGCGCGAGATCGTCGCGGCGGCGCTGGGCCACGCGACG
ACGACCATCTTCGGCAGCATCTGCCAGTCGACGCTCATGTCGCTGATGCTGCGCGCGCCGCTGCTCTTCCTGCCG
CGCAGGATCGGGCTGGGCCTGACGAACCTGGCGGCCTTTTGGGTGCCGACGCCCATCATCGCGCTGACGAACCCG
CTGACGGTGACGTACTCGGCCATCCACTCGCAGTGCCTGGCGACGTCGGCGCGCGGGCTGGACCAGATGGAGGTG
GTGTCGCCGGCGATGCCGACGACGACGCTCACGCCGCGGGCCCTGCGCCTGCGCGGGCAGCCCAACCACGGGCTG
CTCCCGTACCGGCTGGCCAAGCTGCTGCTGGTGGCGACGCGCTTCATCATGGCGACGGGGCTGGGCTTCGCCGGC
TGGGTCATCACGGCCAAGCAGCTGCAGATCCAGCTGCCGGACGGCGTGGGGGTGCGCGGCTCGGCGTACGCCTAC
GTCGTCGGCCTCATGGCCAGCTTCATCGGCTACTCGGTCATGGGGGCCATGGAGGGCATCCTCAGCGGCATCGTC
GACGCCGTGCTCATCTGCTACGGCAGCGAGCGGCGCATGGAGCGCGGCCACGGCCGGTTCTGCCTCGAGGCGGCG
TACCTGTTTGGCGAGAGGCGGATCGGCGACGAGGCATACGCCTAG
Transcript >Hirsu2|10962
ATGTTTTCGGAGTATGCTTCCCGCTTTCTAGCCCAGTCCCAGTCCCGGCTGTCCAACTTGGGCCAGCCCGACTCC
GACCATCCGCCGCGATCGACCGACTGGCCGGCCTCGCGTCCGGGCCGCCACCCGCGAGACGCCGGCCGCGGCGCC
GCCAACGCGCCGCCCGCCAGGTCCTTCCTCGCCCGCGGCTACGCCGGGAGCCCGTACCAGCAGAACGGCGCCGGC
TCGCGCTTCGGCCACCTGGGCTTCGCCTCCCGCATATCGGCCGCCCAGGACGCGCCCCTCTTCCACAGCACCCTC
GACGAGTTCCGCGAAGAGGACGACGAGGGCGAGCGGGAGAGGGAGGCGGCCGACCTGTTCGCGCTGCAGCGGTCG
CGCCGCGTCGCCGCCGCCAGCAAGCTGGCCGAGAGCACCGAGTCGGCCAACAGCCGCACCTCGGTCGACGAGAGC
GCGGGCGACATCGAGAACCCGTACCGCGGCCACGGCCTGGGGCGCGGCATCCGGAGCAGCTGGAACGGCACGAGG
AGCACGCACCAGCCCCGCCCGGCCCAGGATGAGGCCCTGTTCGAGGAGGAGGCCGAGGAGGTGCCGCAGCCGCGG
GGCGATCGATCGGATACCGGCAAGGGCAAGATGGTCGACATCGGCCTGGAATCGCAGGTAGACGGCGACGAGGGC
CCGCCCGGGTCGCTCCTGGCCGGGGAGGGGCCCGCCGACGCGAGCCCCCCCCCCTTCCAGCAGTTCAGCCCGGGC
GCCGAGCGGGAGCCCTTCATCCTCAAGCGGACGTCGACGAGCGACTCGGTCCTGAGCAGCCTGCAGCGCCAGGAC
GCGGCCGAGAGCGAGCCGGCGCAGGCCCTGGGCGAGGGCGAGCTGTTCAAGCACGACCCCTTCTTCGCCTGGATC
TTCCTCATCAGCCTGGCCGGCATGATGTCGACCTTCACCCTCGTCTGGCTGCACACGTCGCCGCGGAAGAGCCCG
GTCGGCGACACCATCTACACGACGCTGCAGCGGTCGTTCGACATGCTGGCCGTCGACACCGTCGTCTCCGTCTTC
GTCTCGCTCGTCTGGCTGGCCGCGCTGCGCTCCTTCGTCCGGCCGCTCGTCAGCGTCATCCTGGTGGCCGTGCCC
GTCATCATGCTCTCCTTCTCCCTCTACTCCTTCGTCTCCTCCTTCCAGGGCCGGACGCACGGGTCCAGCCTGCAG
GACAGCGTGATGCGGTGGGCCTCGCTCGTCCCGGCCGCCGCCTGCCTGCTCTGGCTGTGGCTCGTCGTCAAGGGG
CGGCGGGCGATCCAGCAGGCCATCGAGATCCTGCAGTTCTCGTCCAAGATCCTGGCGCAGAACCCGGGCCTCCTG
CTCGTCGGCTTCGGCTGCCTGGCCCTCATCGTGCTCTGGACGTGGGCCTGGCTGGCCATGTTCACGCGCGTCTTC
ATGGGCGGCTACTTCTCCAAGTCGCTGGTCCGCTTCGTCATCCGCGTCTCGAGCTGGTGGCTGGGCGCGGCCTTC
ATCCTCATGTACCTGTGGACGCTGGCCGTCATCAACGCCGTGCACCGGGCGACGACGGCGGCGACGGTGTCGCAG
TGGTACTTTCACCGCAACGCCGGGCCGGCCACGCCGTCGCGCGAGATCGTCGCGGCGGCGCTGGGCCACGCGACG
ACGACCATCTTCGGCAGCATCTGCCAGTCGACGCTCATGTCGCTGATGCTGCGCGCGCCGCTGCTCTTCCTGCCG
CGCAGGATCGGGCTGGGCCTGACGAACCTGGCGGCCTTTTGGGTGCCGACGCCCATCATCGCGCTGACGAACCCG
CTGACGGTGACGTACTCGGCCATCCACTCGCAGTGCCTGGCGACGTCGGCGCGCGGGCTGGACCAGATGGAGGTG
GTGTCGCCGGCGATGCCGACGACGACGCTCACGCCGCGGGCCCTGCGCCTGCGCGGGCAGCCCAACCACGGGCTG
CTCCCGTACCGGCTGGCCAAGCTGCTGCTGGTGGCGACGCGCTTCATCATGGCGACGGGGCTGGGCTTCGCCGGC
TGGGTCATCACGGCCAAGCAGCTGCAGATCCAGCTGCCGGACGGCGTGGGGGTGCGCGGCTCGGCGTACGCCTAC
GTCGTCGGCCTCATGGCCAGCTTCATCGGCTACTCGGTCATGGGGGCCATGGAGGGCATCCTCAGCGGCATCGTC
GACGCCGTGCTCATCTGCTACGGCAGCGAGCGGCGCATGGAGCGCGGCCACGGCCGGTTCTGCCTCGAGGCGGCG
TACCTGTTTGGCGAGAGGCGGATCGGCGACGAGGCATACGCCTAG
Gene >Hirsu2|10962
ATGTTTTCGGAGTGTGCGCCCGCCTCGCCTCTGCCCGGGCTCCCCGGCACACACACCGGCTGACTCTTGCCGCGC
CGCAGATGCTTCCCGCTTTCTAGCCCAGTCCCAGTCCCGGCTGTCCAACTTGGGCCAGCCCGACTCCGACCATCC
GCCGCGATCGACCGACTGGCCGGCCTCGCGTCCGGGCCGCCACCCGCGAGACGCCGGCCGCGGCGCCGCCAACGC
GCCGCCCGCCAGGTCCTTCCTCGCCCGCGGCTACGCCGGGAGCCCGTACCAGCAGAACGGCGCCGGCTCGCGCTT
CGGCCACCTGGGCTTCGCCTCCCGCATATCGGCCGCCCAGGACGCGCCCCTCTTCCACAGCACCCTCGACGAGTT
CCGCGAAGAGGACGACGAGGGCGAGCGGGAGAGGGAGGCGGCCGACCTGTTCGCGCTGCAGCGGTCGCGCCGCGT
CGCCGCCGCCAGCAAGCTGGCCGAGAGCACCGAGTCGGCCAACAGCCGCACCTCGGTCGACGAGAGCGCGGGCGA
CATCGAGAACCCGTACCGCGGCCACGGCCTGGGGCGCGGCATCCGGAGCAGCTGGAACGGCACGAGGAGCACGCA
CCAGCCCCGCCCGGCCCAGGATGAGGCCCTGTTCGAGGAGGAGGCCGAGGAGGTGCCGCAGCCGCGGGGCGATCG
ATCGGATACCGGCAAGGGCAAGATGGTCGACATCGGCCTGGAATCGCAGGTAGACGGCGACGAGGGCCCGCCCGG
GTCGCTCCTGGCCGGGGAGGGGCCCGCCGACGCGAGCCCCCCCCCCTTCCAGCAGTTCAGCCCGGGCGCCGAGCG
GGAGCCCTTCATCCTCAAGCGGACGTCGACGAGCGACTCGGTCCTGAGCAGCCTGCAGCGCCAGGACGCGGCCGA
GAGCGAGCCGGCGCAGGCCCTGGGCGAGGGCGAGCTGTTCAAGCACGACCCCTTCTTCGCCTGGATCTTCCTCAT
CAGCCTGGCCGGCATGATGTCGACCTTCACCCTCGTCTGGCTGCACACGTCGCCGCGGAAGAGCCCGGTCGGCGA
CACCATCTACACGACGCTGCAGCGGTCGTTCGACATGCTGGCCGTCGACACCGTCGTCTCCGTCTTCGTCTCGCT
CGTCTGGCTGGCCGCGCTGCGCTCCTTCGTCCGGCCGCTCGTCAGCGTCATCCTGGTGGCCGTGCCCGTCATCAT
GCTCTCCTTCTCCCTCTACTCCTTCGTCTCCTCCTTCCAGGGCCGGACGCACGGGTCCAGCCTGCAGGACAGCGT
GATGCGGTGGGCCTCGCTCGTCCCGGCCGCCGCCTGCCTGCTCTGGCTGTGGCTCGTCGTCAAGGGGCGGCGGGC
GATCCAGCAGGCCATCGAGATCCTGCAGTTCTCGTCCAAGATCCTGGCGCAGAACCCGGGCCTCCTGCTCGTCGG
CTTCGGCTGCCTGGCCCTCATCGTGCTCTGGACGTGGGCCTGGCTGGCCATGTTCACGCGCGTCTTCATGGGCGG
CTACTTCTCCAAGTCGCTGGTCCGCTTCGTCATCCGCGTCTCGAGCTGGTGGCTGGGCGCGGCCTTCATCCTCAT
GTACCTGTGGACGCTGGCCGTCATCAACGCCGTGCACCGGGCGACGACGGCGGCGACGGTGTCGCAGTGGTACTT
TCACCGCAACGCCGGGCCGGCCACGCCGTCGCGCGAGATCGTCGCGGCGGCGCTGGGCCACGCGACGACGACCAT
CTTCGGCAGCATCTGCCAGTCGACGCTCATGTCGCTGATGCTGCGCGCGCCGCTGCTCTTCCTGCCGCGCAGGAT
CGGGCTGGGCCTGACGAACCTGGCGGCCTTTTGGGTGCCGACGCCCATCATCGCGCTGACGAACCCGCTGACGGT
GACGTACTCGGCCATCCACTCGCAGTGCCTGGCGACGTCGGCGCGCGGGCTGGACCAGATGGAGGTGGTGTCGCC
GGCGATGCCGACGACGACGCTCACGCCGCGGGCCCTGCGCCTGCGCGGGCAGCCCAACCACGGGCTGCTCCCGTA
CCGGCTGGCCAAGCTGCTGCTGGTGGCGACGCGCTTCATCATGGCGACGGGGCTGGGCTTCGCCGGCTGGGTCAT
CACGGCCAAGCAGCTGCAGATCCAGCTGCCGGACGGCGTGGGGGTGCGCGGCTCGGCGTACGCCTACGTCGTCGG
CCTCATGGCCAGCTTCATCGGCTACTCGGTCATGGGGGCCATGGAGGGCATCCTCAGCGGCATCGTCGACGCCGT
GCTCATCTGCTACGGCAGCGAGCGGCGCATGGAGCGCGGCCACGGCCGGTTCTGCCTCGAGGCGGCGTACCTGTT
TGGCGAGAGGCGGATCGGCGACGAGGCATACGCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail