Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10961
Gene name
LocationContig_934:8345..10540
Strand+
Gene length (bp)2195
Transcript length (bp)1890
Coding sequence length (bp)1890
Protein length (aa) 630

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01843 DIL DIL domain 9.0E-24 542 628
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.8E-07 131 197
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.2E-11 135 227
PF13637 Ank_4 Ankyrin repeats (many copies) 1.1E-04 133 187
PF13637 Ank_4 Ankyrin repeats (many copies) 3.8E-07 177 220
PF00023 Ank Ankyrin repeat 9.0E-03 166 197

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTB0|YL88_SCHPO Dilute domain-containing protein C25B8.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.08 PE=3 SV=1 294 628 8.0E-51
sp|Q9Y4I1|MYO5A_HUMAN Unconventional myosin-Va OS=Homo sapiens GN=MYO5A PE=1 SV=2 363 626 7.0E-18
sp|Q99104|MYO5A_MOUSE Unconventional myosin-Va OS=Mus musculus GN=Myo5a PE=1 SV=2 363 626 1.0E-17
sp|Q9QYF3|MYO5A_RAT Unconventional myosin-Va OS=Rattus norvegicus GN=Myo5a PE=1 SV=1 363 626 1.0E-17
sp|Q02440|MYO5A_CHICK Unconventional myosin-Va OS=Gallus gallus GN=MYO5A PE=1 SV=1 363 626 5.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTB0|YL88_SCHPO Dilute domain-containing protein C25B8.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.08 PE=3 SV=1 294 628 8.0E-51
sp|Q9Y4I1|MYO5A_HUMAN Unconventional myosin-Va OS=Homo sapiens GN=MYO5A PE=1 SV=2 363 626 7.0E-18
sp|Q99104|MYO5A_MOUSE Unconventional myosin-Va OS=Mus musculus GN=Myo5a PE=1 SV=2 363 626 1.0E-17
sp|Q9QYF3|MYO5A_RAT Unconventional myosin-Va OS=Rattus norvegicus GN=Myo5a PE=1 SV=1 363 626 1.0E-17
sp|Q02440|MYO5A_CHICK Unconventional myosin-Va OS=Gallus gallus GN=MYO5A PE=1 SV=1 363 626 5.0E-17
sp|P70569|MYO5B_RAT Unconventional myosin-Vb OS=Rattus norvegicus GN=Myo5b PE=1 SV=1 348 626 1.0E-14
sp|P21271|MYO5B_MOUSE Unconventional myosin-Vb OS=Mus musculus GN=Myo5b PE=1 SV=2 348 626 4.0E-14
sp|Q9ULV0|MYO5B_HUMAN Unconventional myosin-Vb OS=Homo sapiens GN=MYO5B PE=1 SV=3 348 626 5.0E-14
sp|O13585|YP089_YEAST Dilute domain-containing protein YPR089W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR089W PE=1 SV=2 159 495 5.0E-14
sp|O13585|YP089_YEAST Dilute domain-containing protein YPR089W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR089W PE=1 SV=2 501 589 7.0E-11
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 153 239 2.0E-09
sp|Q5XJ13|ANKS6_DANRE Ankyrin repeat and SAM domain-containing protein 6 OS=Danio rerio GN=anks6 PE=2 SV=1 160 250 3.0E-09
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 125 237 4.0E-09
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 158 254 6.0E-09
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 125 237 7.0E-09
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 158 254 9.0E-09
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 160 250 1.0E-08
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 160 250 2.0E-08
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 160 250 2.0E-08
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 158 254 2.0E-08
sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 28 235 2.0E-08
sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 56 235 4.0E-08
sp|Q9QW30|NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 56 235 4.0E-08
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 159 254 6.0E-08
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 159 254 7.0E-08
sp|Q811D2|ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus GN=Ankrd26 PE=1 SV=2 137 240 2.0E-07
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 80 235 6.0E-07
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 133 239 9.0E-07
sp|Q69Z89|RADIL_MOUSE Ras-associating and dilute domain-containing protein OS=Mus musculus GN=Radil PE=1 SV=2 333 587 1.0E-06
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 153 237 1.0E-06
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 125 225 2.0E-06
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 156 241 2.0E-06
sp|Q2IBB4|ASZ1_RHIFE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 125 249 3.0E-06
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 133 239 4.0E-06
sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 164 239 4.0E-06
sp|Q7T0Q1|MTPN_XENLA Myotrophin OS=Xenopus laevis GN=mtpn PE=3 SV=1 129 238 4.0E-06
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 125 225 4.0E-06
sp|A1X154|ASZ1_ECHTE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 123 235 6.0E-06
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 133 235 6.0E-06
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 133 239 6.0E-06
sp|Q9SM23|ACBP1_ARATH Acyl-CoA-binding domain-containing protein 1 OS=Arabidopsis thaliana GN=ACBP1 PE=1 SV=2 158 248 6.0E-06
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 153 237 7.0E-06
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 134 251 7.0E-06
sp|P58546|MTPN_HUMAN Myotrophin OS=Homo sapiens GN=MTPN PE=1 SV=2 129 238 8.0E-06
sp|Q863Z4|MTPN_CANLF Myotrophin OS=Canis lupus familiaris GN=MTPN PE=3 SV=3 129 238 8.0E-06
sp|Q3T0F7|MTPN_BOVIN Myotrophin OS=Bos taurus GN=MTPN PE=1 SV=3 129 238 8.0E-06
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 158 237 8.0E-06
sp|Q07DV3|ASZ1_AOTNA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 123 234 8.0E-06
sp|A4D7T3|ASZ1_MACEU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 161 236 9.0E-06
sp|Q2QLG0|ASZ1_CALJA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 123 234 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10961
MDLGDSTGSDGGHKPRVIPPDLPRSLDDRRHAPSEGFVPETEMYDGWQGQSQFLTTPALAKPLNFGNLSLNDADY
EAAAAAADGPKDSDARLMEMLQVQAAANQAGQGLEDEQAVVDDEKLSEAEKKEMLQRALTMAASNGDVAKVRRLV
GGKAGAFIDVNAPDEDGTPPLIYASCFGHEGVVQALIEARADVNRQDRNQWSALMWAMTNRHKGIAKLLLDNKAS
SDQKTSSGRTAFDFVPPDSEMSYYLHNNGYNLGNAGVPDDFYSPGFSQDRFEEEMAENEMRRRLMMESARDLEVD
LGNVGMDDQPEPADEFEEEQQEFDWSRCLHDQMFVFQESELDRILDIVITKMTPQRSPSQKPVPANMIFLSARYA
HYHSSPELLERLLVTAMDRINDVVERCQWDMTILAFWLSNATLLLHYLKKDAGLVEATSEFQAHLAELVNEIFIL
IVRDAERRLDKVLDAAMLDHETIPGFEDITFQNEWKLFKRKTTVKEEPPEKRFRPPSPKRRAKPAPRNVTSLLSS
TLFVLDLYDVHSVITAQIVSQLLYWIGAELFNRVMSNRKYLARTKAMQIRMNISILEDWARTNNRQAEHYEGGET
RSSGDTTTDAARRHLAPCIQLLQWLQCFS*
Coding >Hirsu2|10961
ATGGACCTGGGCGACTCGACCGGCAGCGACGGCGGACACAAGCCCCGCGTCATCCCCCCCGATCTTCCCCGATCG
CTCGACGACCGCCGCCACGCGCCCTCCGAGGGCTTCGTGCCCGAGACGGAGATGTATGACGGCTGGCAAGGCCAG
TCTCAGTTCCTCACGACGCCCGCGCTCGCCAAGCCGCTCAATTTCGGAAACCTGTCGCTCAACGACGCCGACTAC
GAAGCCGCCGCCGCCGCCGCCGACGGCCCCAAGGACAGCGATGCCAGGCTGATGGAGATGCTGCAGGTCCAGGCC
GCCGCCAACCAGGCCGGCCAGGGCCTCGAGGATGAGCAGGCCGTCGTCGACGACGAGAAGCTGTCCGAGGCGGAG
AAGAAGGAGATGCTCCAGAGGGCGCTGACCATGGCCGCCAGCAACGGCGACGTCGCCAAGGTCAGGCGCCTCGTC
GGCGGCAAGGCCGGCGCCTTCATCGACGTCAACGCCCCGGACGAGGACGGCACGCCGCCCCTCATCTACGCCAGC
TGTTTTGGCCACGAGGGCGTGGTGCAGGCCCTGATAGAGGCCCGCGCCGACGTCAACAGGCAGGACCGAAACCAG
TGGAGCGCCCTGATGTGGGCCATGACCAACCGCCACAAGGGCATCGCCAAGCTCCTGCTCGACAACAAGGCGTCC
TCGGACCAGAAGACGTCGTCGGGCCGGACCGCCTTCGACTTCGTGCCGCCCGACAGCGAAATGTCGTACTACCTC
CACAACAACGGCTACAACCTGGGCAACGCCGGCGTCCCGGACGACTTCTACAGCCCGGGCTTCTCGCAGGACCGG
TTCGAGGAGGAGATGGCGGAGAACGAGATGCGGAGGCGGCTGATGATGGAGAGCGCCCGCGACCTCGAGGTCGAC
CTGGGCAACGTCGGCATGGACGACCAGCCCGAGCCGGCCGACGAGTTCGAGGAGGAGCAGCAGGAGTTCGACTGG
AGCCGCTGCCTGCACGACCAGATGTTCGTGTTCCAGGAGAGCGAGCTGGACCGGATACTGGACATTGTCATCACC
AAGATGACGCCGCAGCGGTCGCCGTCGCAGAAGCCGGTGCCGGCCAACATGATCTTCCTCAGCGCCCGCTACGCG
CACTACCACTCGAGCCCGGAGCTGCTGGAGAGGCTGCTCGTCACGGCCATGGACCGCATCAACGACGTGGTGGAG
CGGTGCCAGTGGGACATGACGATCCTGGCCTTTTGGCTCTCCAACGCGACGCTGCTGCTGCACTACCTCAAGAAG
GACGCCGGGCTGGTGGAGGCGACGTCGGAGTTCCAGGCGCACCTGGCCGAGCTGGTCAACGAGATCTTCATCCTC
ATCGTGCGCGACGCGGAGCGGCGGCTGGACAAGGTGCTGGACGCGGCCATGCTGGACCACGAGACGATACCCGGC
TTCGAGGACATCACCTTCCAGAACGAGTGGAAACTGTTCAAGCGCAAGACGACGGTCAAGGAGGAGCCGCCGGAG
AAGCGGTTCCGGCCGCCGTCGCCGAAGCGGCGGGCGAAGCCGGCGCCGCGCAACGTGACGTCGCTGCTGTCGTCG
ACGCTCTTCGTGCTGGACCTCTACGACGTGCACTCGGTCATCACGGCACAGATCGTGTCGCAGCTGCTGTACTGG
ATCGGGGCCGAGCTCTTCAACCGCGTCATGTCGAACCGCAAGTACCTGGCGCGGACCAAGGCGATGCAGATCCGG
ATGAACATCTCCATCCTCGAGGACTGGGCCCGGACCAACAACCGGCAGGCCGAGCACTACGAGGGCGGCGAGACG
CGGTCGTCGGGCGACACGACGACGGACGCGGCGCGGCGGCACCTGGCGCCCTGCATCCAGCTGCTGCAGTGGCTG
CAGTGCTTCTCCTGA
Transcript >Hirsu2|10961
ATGGACCTGGGCGACTCGACCGGCAGCGACGGCGGACACAAGCCCCGCGTCATCCCCCCCGATCTTCCCCGATCG
CTCGACGACCGCCGCCACGCGCCCTCCGAGGGCTTCGTGCCCGAGACGGAGATGTATGACGGCTGGCAAGGCCAG
TCTCAGTTCCTCACGACGCCCGCGCTCGCCAAGCCGCTCAATTTCGGAAACCTGTCGCTCAACGACGCCGACTAC
GAAGCCGCCGCCGCCGCCGCCGACGGCCCCAAGGACAGCGATGCCAGGCTGATGGAGATGCTGCAGGTCCAGGCC
GCCGCCAACCAGGCCGGCCAGGGCCTCGAGGATGAGCAGGCCGTCGTCGACGACGAGAAGCTGTCCGAGGCGGAG
AAGAAGGAGATGCTCCAGAGGGCGCTGACCATGGCCGCCAGCAACGGCGACGTCGCCAAGGTCAGGCGCCTCGTC
GGCGGCAAGGCCGGCGCCTTCATCGACGTCAACGCCCCGGACGAGGACGGCACGCCGCCCCTCATCTACGCCAGC
TGTTTTGGCCACGAGGGCGTGGTGCAGGCCCTGATAGAGGCCCGCGCCGACGTCAACAGGCAGGACCGAAACCAG
TGGAGCGCCCTGATGTGGGCCATGACCAACCGCCACAAGGGCATCGCCAAGCTCCTGCTCGACAACAAGGCGTCC
TCGGACCAGAAGACGTCGTCGGGCCGGACCGCCTTCGACTTCGTGCCGCCCGACAGCGAAATGTCGTACTACCTC
CACAACAACGGCTACAACCTGGGCAACGCCGGCGTCCCGGACGACTTCTACAGCCCGGGCTTCTCGCAGGACCGG
TTCGAGGAGGAGATGGCGGAGAACGAGATGCGGAGGCGGCTGATGATGGAGAGCGCCCGCGACCTCGAGGTCGAC
CTGGGCAACGTCGGCATGGACGACCAGCCCGAGCCGGCCGACGAGTTCGAGGAGGAGCAGCAGGAGTTCGACTGG
AGCCGCTGCCTGCACGACCAGATGTTCGTGTTCCAGGAGAGCGAGCTGGACCGGATACTGGACATTGTCATCACC
AAGATGACGCCGCAGCGGTCGCCGTCGCAGAAGCCGGTGCCGGCCAACATGATCTTCCTCAGCGCCCGCTACGCG
CACTACCACTCGAGCCCGGAGCTGCTGGAGAGGCTGCTCGTCACGGCCATGGACCGCATCAACGACGTGGTGGAG
CGGTGCCAGTGGGACATGACGATCCTGGCCTTTTGGCTCTCCAACGCGACGCTGCTGCTGCACTACCTCAAGAAG
GACGCCGGGCTGGTGGAGGCGACGTCGGAGTTCCAGGCGCACCTGGCCGAGCTGGTCAACGAGATCTTCATCCTC
ATCGTGCGCGACGCGGAGCGGCGGCTGGACAAGGTGCTGGACGCGGCCATGCTGGACCACGAGACGATACCCGGC
TTCGAGGACATCACCTTCCAGAACGAGTGGAAACTGTTCAAGCGCAAGACGACGGTCAAGGAGGAGCCGCCGGAG
AAGCGGTTCCGGCCGCCGTCGCCGAAGCGGCGGGCGAAGCCGGCGCCGCGCAACGTGACGTCGCTGCTGTCGTCG
ACGCTCTTCGTGCTGGACCTCTACGACGTGCACTCGGTCATCACGGCACAGATCGTGTCGCAGCTGCTGTACTGG
ATCGGGGCCGAGCTCTTCAACCGCGTCATGTCGAACCGCAAGTACCTGGCGCGGACCAAGGCGATGCAGATCCGG
ATGAACATCTCCATCCTCGAGGACTGGGCCCGGACCAACAACCGGCAGGCCGAGCACTACGAGGGCGGCGAGACG
CGGTCGTCGGGCGACACGACGACGGACGCGGCGCGGCGGCACCTGGCGCCCTGCATCCAGCTGCTGCAGTGGCTG
CAGTGCTTCTCCTGA
Gene >Hirsu2|10961
ATGGACCTGGGCGACTCGACCGGCAGCGACGGCGGACACAAGCCCCGCGTCATCCCCCCCGATCTTCCCCGATCG
CTCGACGACCGCCGCCACGCGCCCTCCGAGGGCTTCGTGCCCGAGACGGAGATGTATGACGGCTGGCAAGGTCGG
TCCGGCCCCTTCTGCAATCCCTCCTCCACCCTGCCCCCCCGTTGGACCCAGTCTTTTCTAACGGTTTGCCTCTCG
TCTCCCTTCCAGGCCAGTCTCAGTTCCTCACGACGCCCGCGCTCGCCAAGCCGCTCAATTTCGGAAACCTGTCGC
TCAACGACGCCGACTACGAAGCCGCCGCCGCCGCCGCCGACGGCCCCAAGGACAGCGATGCCAGGCTGATGGAGA
TGCTGCAGGTCCAGGCCGCCGCCAACCAGGCCGGCCAGGGCCTCGAGGATGAGCAGGCCGTCGTCGACGACGAGA
AGCTGTCCGAGGCGGAGAAGAAGGAGATGCTCCAGAGGGCGCTGACCATGGCCGCCAGCAACGGCGACGTCGCCA
AGGTCAGGCGCCTCGTCGGCGGCAAGGCCGGCGCCTTCATCGACGTCAACGCCCCGGACGAGGACGGCACGCCGC
CCCTCATCTACGCCAGCTGTTTTGTAGGTCGAGCCCTTCCCCTCGGCCCGTCGTATCCCTCTCCGCCCACCCAGG
CTGACCGGACTCGTCCCACAAGGGCCACGAGGGCGTGGTGCAGGCCCTGATAGAGGCCCGCGCCGACGTCAACAG
GCAGGACCGAAACCAGTGGAGCGCCCTGATGTGGGCCATGACCAACCGCCACAAGGGCATCGCCAAGCTCCTGCT
CGACAACAAGGCGTCCTCGGACCAGAAGACGTCGTCGGGCCGGACCGCCTTCGACTTCGTGCCGCCCGACAGCGA
AATGTCGTACTACCTCCACAACAACGGCTACAACCTGGGCAACGCCGGCGTCCCGGACGACTTCTACAGCCCGGG
CTTCTCGCAGGACCGGTTCGAGGAGGAGATGGCGGAGAACGAGATGCGGAGGCGGCTGATGATGGAGAGCGCCCG
CGACCTCGAGGTCGACCTGGGCAACGTCGGCATGGACGACCAGCCCGAGGTAGGTTTGCGACGGGCTTGGGCGCG
CGGGGCTGGGCCACACGCTGACGCGCACCCCCCCTCGCAGCCGGCCGACGAGTTCGAGGAGGAGCAGCAGGAGTT
CGACTGGAGCCGCTGCCTGCACGACCAGATGTTCGTGTTCCAGGAGAGCGAGCTGGACCGGATACTGGACATTGT
CATCACCAAGATGACGCCGCAGCGGTCGCCGTCGCAGAAGCCGGTGCCGGCCAACATGATCTTCCTCAGCGCCCG
CTACGCGCACTACCACTCGAGCCCGGAGCTGCTGGAGAGGCTGCTCGTCACGGCCATGGACCGCATCAACGACGT
GGTGGAGCGGTGCCAGTGGGACATGACGATCCTGGCCTTTTGGCTCTCCAACGCGACGCTGCTGCTGCACTACCT
CAAGAAGGACGCCGGGCTGGTGGAGGCGACGTCGGAGTTCCAGGCGCACCTGGCCGAGCTGGTCAACGAGATCTT
CATCCTCATCGTGCGCGACGCGGAGCGGCGGCTGGACAAGGTGCTGGACGCGGCCATGCTGGACCACGAGACGAT
ACCCGGCTTCGAGGACATCACCTTCCAGAACGAGTGGAAACTGTTCAAGCGCAAGACGACGGTCAAGGAGGAGCC
GCCGGAGAAGCGGTTCCGGCCGCCGTCGCCGAAGCGGCGGGCGAAGCCGGCGCCGCGCAACGTGACGTCGCTGCT
GTCGTCGACGCTCTTCGTGCTGGACCTCTACGACGTGCACTCGGTCATCACGGCACAGATCGTGTCGCAGCTGCT
GTACTGGATCGGGGCCGAGCTCTTCAACCGCGTCATGTCGAACCGCAAGTACCTGGCGCGGACCAAGGCGATGCA
GATCCGGATGAACATCTCCATCCTCGAGGACTGGGCCCGGACCAACAACCGGCAGGCCGAGCACTACGAGGGCGG
CGAGACGCGGTCGTCGGGCGACACGACGACGGACGCGGCGCGGCGGCACCTGGCGCCCTGCATCCAGCTGCTGCA
GTGGCTGCAGTGCTTCTCGTCGCTCGGGCCGGACGACCTGGAGGCGCTGGTCGGCACGCTTCAGCAGCTGAAGAG
GCTGACGCCGCAGCAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail