Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10959
Gene name
LocationContig_934:3657..4511
Strand-
Gene length (bp)854
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03188 Cytochrom_B561 Eukaryotic cytochrome b561 1.5E-16 77 205

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q925G2|CYBR1_MOUSE Cytochrome b reductase 1 OS=Mus musculus GN=Cybrd1 PE=1 SV=2 74 201 7.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 71 93 22
3 114 131 17
4 146 168 22
5 188 207 19
6 212 234 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10959
MASTAATVPADEVARPEATDTEPLLGRPGDVSQRRDGSFARNLVMGTGAVAQLGAVLLLVLIWASVLTHPLILFS
AHPLLQSLAVFVLIQSVLSLQPTHTSEQKRLGQRVHASLNLVAFLLLVAGVSIIEYNKLASRGPHFHSVHGYLGV
ISGIVLLLQYLVGFTMWATPALYGGEDRARAVWKYHRYSGYLVLVLLLATVCSATDTSYNDMVLHIKLWATVLAS
VLVVVGVFPRIQKHKLGLATYSAAAQEAPRPRYSDQ*
Coding >Hirsu2|10959
ATGGCCAGCACGGCGGCGACGGTGCCGGCGGACGAGGTGGCGCGGCCGGAAGCCACGGACACGGAGCCGCTGCTG
GGGCGGCCCGGCGACGTCAGCCAGCGCCGAGATGGCTCCTTTGCCCGGAACCTCGTCATGGGCACGGGCGCCGTG
GCCCAGCTCGGGGCCGTCCTCCTCCTCGTCCTCATCTGGGCCTCGGTCCTCACCCACCCGCTGATACTGTTCTCG
GCTCACCCGCTGCTGCAGTCGCTGGCCGTCTTCGTCCTGATCCAGTCGGTGCTGTCGCTGCAGCCGACGCACACG
AGTGAGCAGAAGCGGCTGGGCCAGCGCGTGCACGCCTCGCTCAACCTCGTCGCCTTCCTGCTGCTCGTGGCCGGC
GTGAGCATCATCGAGTACAACAAGCTGGCCAGCCGCGGCCCGCACTTCCACTCCGTCCACGGCTACCTGGGCGTC
ATCAGCGGCATCGTCCTGCTGCTGCAGTACCTCGTCGGCTTCACCATGTGGGCCACGCCCGCCCTCTACGGCGGC
GAGGACCGGGCCCGCGCCGTCTGGAAGTACCACCGCTACTCGGGCTACCTCGTCCTCGTCCTCCTGCTCGCCACC
GTCTGCAGCGCGACCGACACCTCGTACAACGACATGGTGTTGCACATCAAGCTCTGGGCCACCGTCCTCGCCTCC
GTCCTCGTCGTCGTCGGCGTCTTCCCCCGCATCCAGAAGCACAAGCTCGGCCTGGCCACCTACTCCGCCGCCGCG
CAGGAAGCCCCGAGACCGCGCTACTCCGACCAATAA
Transcript >Hirsu2|10959
ATGGCCAGCACGGCGGCGACGGTGCCGGCGGACGAGGTGGCGCGGCCGGAAGCCACGGACACGGAGCCGCTGCTG
GGGCGGCCCGGCGACGTCAGCCAGCGCCGAGATGGCTCCTTTGCCCGGAACCTCGTCATGGGCACGGGCGCCGTG
GCCCAGCTCGGGGCCGTCCTCCTCCTCGTCCTCATCTGGGCCTCGGTCCTCACCCACCCGCTGATACTGTTCTCG
GCTCACCCGCTGCTGCAGTCGCTGGCCGTCTTCGTCCTGATCCAGTCGGTGCTGTCGCTGCAGCCGACGCACACG
AGTGAGCAGAAGCGGCTGGGCCAGCGCGTGCACGCCTCGCTCAACCTCGTCGCCTTCCTGCTGCTCGTGGCCGGC
GTGAGCATCATCGAGTACAACAAGCTGGCCAGCCGCGGCCCGCACTTCCACTCCGTCCACGGCTACCTGGGCGTC
ATCAGCGGCATCGTCCTGCTGCTGCAGTACCTCGTCGGCTTCACCATGTGGGCCACGCCCGCCCTCTACGGCGGC
GAGGACCGGGCCCGCGCCGTCTGGAAGTACCACCGCTACTCGGGCTACCTCGTCCTCGTCCTCCTGCTCGCCACC
GTCTGCAGCGCGACCGACACCTCGTACAACGACATGGTGTTGCACATCAAGCTCTGGGCCACCGTCCTCGCCTCC
GTCCTCGTCGTCGTCGGCGTCTTCCCCCGCATCCAGAAGCACAAGCTCGGCCTGGCCACCTACTCCGCCGCCGCG
CAGGAAGCCCCGAGACCGCGCTACTCCGACCAATAA
Gene >Hirsu2|10959
ATGGCCAGCACGGCGGCGACGGTGCCGGCGGACGAGGTGGCGCGGCCGGAAGCCACGGACACGGAGCCGCTGCTG
GGGCGGCCCGGCGACGTCAGCCAGCGCCGAGATGGCTCCTTTGCCCGGAACCTCGTCATGGGTGAGTCGGGGCGG
GAATGGCTGGTCGACTGACGTCGGACGACGACGGCTGACGCTTCTCTCTCCCAGGCACGGGCGCCGTGGCCCAGC
TCGGGGCCGTCCTCCTCCTCGTCCTCATCTGGGCCTCGGTCCTCACCCACCCGCTGATACTGTTCTCGGCTCACC
CGCTGCTGCAGTCGCTGGCCGTCTTCGTCCTGATCCAGTCGGTGCTGTCGCTGCAGCCGACGCACACGAGTGAGC
AGAAGCGGCTGGGCCAGCGCGTGCACGCCTCGCTCAACCTCGTCGCCTTCCTGCTGCTCGTGGCCGGCGTGAGCA
TCATCGAGTACAACAAGCTGGCCAGCCGCGGCCCGCACTTCCACTCCGTCCACGGCTACCTGGGCGTCATCAGCG
GCATCGTCCTGCTGCTGCAGTACCTCGTCGGCTTCACCATGTGGGCCACGCCCGCCCTCTACGGCGGCGAGGACC
GGGCCCGCGCCGTCTGGAAGTACCACCGCTACTCGGGCTACCTCGTCCTCGTCCTCCTGCTCGCCACCGTCTGCA
GCGCGACCGACACCTCGTACAACGACATGGTGTTGCACATCAAGCTCTGGGCCACCGTCCTCGCCTCCGTCCTCG
TCGTCGTCGGCGTCTTCCCCCGCATCCAGAAGCACAAGCTCGGCCTGGCCACCTACTCCGCCGCCGCGCAGGAAG
CCCCGAGACCGCGCTACTCCGACCAATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail