Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10950
Gene name
LocationContig_931:9945..10548
Strand+
Gene length (bp)603
Transcript length (bp)432
Coding sequence length (bp)432
Protein length (aa) 144

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01755 Glyco_transf_25 Glycosyltransferase family 25 (LPS biosynthesis protein) 9.9E-08 74 142

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.1355 0.1214 0.3092 0.0994 0.1435 0.01 0.457 0.1621 0.9011 0.0236

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 10 27 17

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT25 2.0E-17 73 143

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6943
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|10950 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2516
Ophiocordyceps subramaniannii Hirsu2|4702

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10950
MGRAISPRRSLWALGTVLVLFVLLVLRREQLMAAGGPRPQYFLKAKPARAAIARPSPPGASPDTIQNSTLGFERI
FVVSLPTRTDRRDAFALQAAVTDIHFEFVDGVRGSDMAENAIPKTEAGQHIADAELGCWRSHMNVMQE*
Coding >Hirsu2|10950
ATGGGCCGCGCCATCTCGCCCAGGCGATCGCTATGGGCTCTCGGGACCGTCCTCGTTCTGTTCGTGCTGCTGGTC
CTTCGCAGGGAGCAGCTGATGGCGGCCGGGGGACCTCGGCCGCAGTACTTCCTGAAAGCGAAGCCGGCTCGAGCG
GCGATCGCGCGGCCGAGTCCTCCCGGCGCATCCCCGGACACCATCCAGAACAGCACGCTGGGCTTCGAGCGGATC
TTCGTCGTCAGCCTGCCCACGCGGACGGACCGGCGCGATGCCTTTGCCCTCCAGGCGGCCGTGACCGACATACAC
TTCGAGTTCGTTGACGGCGTGCGCGGCTCGGACATGGCGGAGAATGCCATCCCGAAAACCGAGGCCGGGCAGCAC
ATCGCCGATGCCGAGCTGGGCTGCTGGCGAAGCCACATGAACGTGATGCAAGAGTGA
Transcript >Hirsu2|10950
ATGGGCCGCGCCATCTCGCCCAGGCGATCGCTATGGGCTCTCGGGACCGTCCTCGTTCTGTTCGTGCTGCTGGTC
CTTCGCAGGGAGCAGCTGATGGCGGCCGGGGGACCTCGGCCGCAGTACTTCCTGAAAGCGAAGCCGGCTCGAGCG
GCGATCGCGCGGCCGAGTCCTCCCGGCGCATCCCCGGACACCATCCAGAACAGCACGCTGGGCTTCGAGCGGATC
TTCGTCGTCAGCCTGCCCACGCGGACGGACCGGCGCGATGCCTTTGCCCTCCAGGCGGCCGTGACCGACATACAC
TTCGAGTTCGTTGACGGCGTGCGCGGCTCGGACATGGCGGAGAATGCCATCCCGAAAACCGAGGCCGGGCAGCAC
ATCGCCGATGCCGAGCTGGGCTGCTGGCGAAGCCACATGAACGTGATGCAAGAGTGA
Gene >Hirsu2|10950
ATGGGCCGCGCCATCTCGCCCAGGCGATCGCTATGGGCTCTCGGGACCGTCCTCGTTCTGTTCGTGCTGCTGGTC
CTTCGCAGGGAGCAGCTGATGGCGGCCGGGGGACCTCGGCCGCAGTACTTCCTGAAAGCGAAGCCGGCTCGAGCG
GCGATCGCGCGGCCGAGTCCTCCCGGCGCATCCCCGGACACCATCCAGAACAGCACGCTGGGCGTGAGTTGGAAC
CTGCTTCGTTTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTCCTGTGTCGTGTGTCGCTCGCTTCCCCCCCC
TCCCCCCACCCAAGGTGCTGATGAAGACGTGTGCTGTTCGCGGAACAAACTCTGACGGGGCGCTCACGCCCTTGG
CGCACGTAGTTCGAGCGGATCTTCGTCGTCAGCCTGCCCACGCGGACGGACCGGCGCGATGCCTTTGCCCTCCAG
GCGGCCGTGACCGACATACACTTCGAGTTCGTTGACGGCGTGCGCGGCTCGGACATGGCGGAGAATGCCATCCCG
AAAACCGAGGCCGGGCAGCACATCGCCGATGCCGAGCTGGGCTGCTGGCGAAGCCACATGAACGTGATGCAAGAG
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail