Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10944
Gene name
LocationContig_93:38525..39965
Strand-
Gene length (bp)1440
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13938|YEP4_SCHPO UPF0658 Golgi apparatus membrane protein C23H3.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H3.04 PE=3 SV=3 66 377 5.0E-50
sp|Q9UUJ8|YLOA_SCHPO UPF0658 Golgi apparatus membrane protein C1952.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1952.10c PE=3 SV=1 68 407 3.0E-35

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

Domain # Start End Length
1 72 94 22
2 114 136 22
3 143 165 22
4 198 220 22
5 246 268 22
6 278 297 19
7 304 322 18
8 342 364 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10944
LATSHYDHGRDPSREYGQAYPQAAYHQPAYAENANLNHSFDQGYAHRQGMAPSTPARSVYHDRVGFLKTKWPAAF
MAVTSLQAVVCLGFESYVFAKFQTSLGLWVDKPEVQSQYKTIPTFLTLFIFGFLYELVVVWDALRMKNTIQVIGV
CIANLALLVYTAIQVDQIQTALEVLGRESALKLGITPAQLWADVRPFLIAIPAIIALATVVMMFIAWKLYQEFAW
DILKNIGADYRMKKRFLHYQIYIALLKFDFFFFLGFIIQFVVVVAQKSDPEFALTIATIPITIGILLAAAYFTRR
ENKAGMMVIIILYLGGLTYFIFKLCRIYQPEYQESYKAVRKSLTAFAVITILLILLTIINAIICMRNFDKGLKAH
LLSSRRVEEKPDAHSISLHDVKPQLPSRMTID*
Coding >Hirsu2|10944
CTGGCTACCAGTCACTACGACCACGGCCGCGACCCCTCGAGAGAATACGGCCAGGCTTATCCCCAAGCCGCCTAT
CACCAGCCCGCCTACGCTGAGAATGCCAACCTGAACCACAGCTTCGACCAAGGCTACGCTCACCGACAAGGCATG
GCGCCCTCTACTCCAGCCCGAAGCGTCTACCACGACAGGGTCGGCTTCCTCAAGACCAAGTGGCCCGCCGCCTTC
ATGGCCGTCACCAGCCTGCAGGCCGTCGTCTGCCTTGGCTTCGAGTCATACGTCTTCGCCAAGTTCCAGACCAGT
CTCGGCCTGTGGGTGGACAAGCCCGAGGTCCAGTCTCAGTACAAGACGATCCCTACCTTCTTGACCCTCTTCATC
TTCGGCTTCCTCTACGAGCTGGTCGTTGTCTGGGACGCCCTGCGCATGAAGAACACCATCCAGGTCATTGGCGTC
TGCATCGCCAACCTGGCCCTGCTCGTCTACACCGCCATCCAGGTCGACCAGATCCAGACGGCCCTCGAGGTCTTG
GGGCGCGAGTCGGCCCTCAAGCTCGGCATCACCCCCGCCCAGCTCTGGGCCGACGTCAGGCCCTTTCTCATTGCC
ATCCCCGCCATCATCGCCCTCGCCACCGTCGTCATGATGTTTATTGCCTGGAAGCTCTACCAGGAGTTTGCCTGG
GACATCCTCAAGAACATCGGCGCCGACTACCGCATGAAGAAGCGCTTCCTGCACTACCAGATCTACATTGCCCTG
CTCAAGTTCGATTTCTTCTTCTTCCTCGGCTTCATCATCCAGTTCGTCGTCGTCGTCGCCCAGAAGTCGGACCCC
GAGTTCGCCCTGACCATTGCCACCATCCCCATCACCATCGGCATCCTGCTCGCCGCCGCCTACTTCACCCGCCGG
GAGAACAAGGCCGGCATGATGGTCATCATCATCCTCTACCTCGGCGGCCTCACCTACTTCATCTTCAAGCTGTGC
CGCATCTACCAGCCCGAGTACCAGGAATCCTACAAGGCCGTGCGCAAGTCCCTCACCGCCTTCGCCGTCATCACC
ATCCTCCTCATCCTCCTCACCATCATCAACGCCATCATCTGCATGCGCAACTTCGACAAGGGGCTCAAGGCACAC
CTGCTGTCCTCGCGGCGAGTGGAAGAGAAGCCCGACGCCCACTCCATCAGTCTGCACGACGTCAAGCCCCAGCTG
CCCAGCCGCATGACCATCGACTGA
Transcript >Hirsu2|10944
CTGGCTACCAGTCACTACGACCACGGCCGCGACCCCTCGAGAGAATACGGCCAGGCTTATCCCCAAGCCGCCTAT
CACCAGCCCGCCTACGCTGAGAATGCCAACCTGAACCACAGCTTCGACCAAGGCTACGCTCACCGACAAGGCATG
GCGCCCTCTACTCCAGCCCGAAGCGTCTACCACGACAGGGTCGGCTTCCTCAAGACCAAGTGGCCCGCCGCCTTC
ATGGCCGTCACCAGCCTGCAGGCCGTCGTCTGCCTTGGCTTCGAGTCATACGTCTTCGCCAAGTTCCAGACCAGT
CTCGGCCTGTGGGTGGACAAGCCCGAGGTCCAGTCTCAGTACAAGACGATCCCTACCTTCTTGACCCTCTTCATC
TTCGGCTTCCTCTACGAGCTGGTCGTTGTCTGGGACGCCCTGCGCATGAAGAACACCATCCAGGTCATTGGCGTC
TGCATCGCCAACCTGGCCCTGCTCGTCTACACCGCCATCCAGGTCGACCAGATCCAGACGGCCCTCGAGGTCTTG
GGGCGCGAGTCGGCCCTCAAGCTCGGCATCACCCCCGCCCAGCTCTGGGCCGACGTCAGGCCCTTTCTCATTGCC
ATCCCCGCCATCATCGCCCTCGCCACCGTCGTCATGATGTTTATTGCCTGGAAGCTCTACCAGGAGTTTGCCTGG
GACATCCTCAAGAACATCGGCGCCGACTACCGCATGAAGAAGCGCTTCCTGCACTACCAGATCTACATTGCCCTG
CTCAAGTTCGATTTCTTCTTCTTCCTCGGCTTCATCATCCAGTTCGTCGTCGTCGTCGCCCAGAAGTCGGACCCC
GAGTTCGCCCTGACCATTGCCACCATCCCCATCACCATCGGCATCCTGCTCGCCGCCGCCTACTTCACCCGCCGG
GAGAACAAGGCCGGCATGATGGTCATCATCATCCTCTACCTCGGCGGCCTCACCTACTTCATCTTCAAGCTGTGC
CGCATCTACCAGCCCGAGTACCAGGAATCCTACAAGGCCGTGCGCAAGTCCCTCACCGCCTTCGCCGTCATCACC
ATCCTCCTCATCCTCCTCACCATCATCAACGCCATCATCTGCATGCGCAACTTCGACAAGGGGCTCAAGGCACAC
CTGCTGTCCTCGCGGCGAGTGGAAGAGAAGCCCGACGCCCACTCCATCAGTCTGCACGACGTCAAGCCCCAGCTG
CCCAGCCGCATGACCATCGACTGA
Gene >Hirsu2|10944
CTGGCTACCAGGTTAGATTCTCGCAAGTCCCTGCTGGGCCCAGATCCGGACTTCTCACAGCTCAGCCCGCAACAC
AGTCACTACGACCACGGCCGCGACCCCTCGAGAGAATACGGCCAGGCTTATCCCCAAGCCGCCTATCACCAGCCC
GCCTACGCTGAGAATGCCAACCTGAACCACAGCTTCGACCAAGGCTACGCTCACCGACAAGGCATGGCGCCCTCT
ACTCCAGCCCGAAGCGTCTACCACGACAGGGTCGGCTTCCTCAAGACCAAGTGGCCCGCCGCCTTCATGGCCGTC
ACCAGCCTGCAGGCCGTCGTCTGCCTTGGCTTCGAGTCGTACGTTCGCCCCTCCGCCGCCCTCTGCCCCGTCTCG
CCCTCGACGCCCCCTCATACACCTTTGACTGACGCTCCCTCTTCCCCTCAGATACGTCTTCGCCAAGTTCCAGAC
CAGTCTCGGCCTGTGGGTGGACAAGCCCGAGGTCCAGTCTCAGTACAAGACGATCCCTACCTTCTTGACCCTCTT
CATCTTCGGCTTCCTCTACGAGCTGGTCGTTGTCTGGGACGCCCTGCGCATGAAGAACACCATCCAGGTCATTGG
CGTCTGCATCGCCAACCTGGCCCTGCTCGTCTACACCGCCATCCAGGTCGACCAGATCCAGACGGCCCTCGAGGT
CTTGGGGCGCGAGTCGGCCCTCAAGCTCGGCATCACCCCCGCCCAGCTCTGGGCCGACGTCAGGCCCTTTCTCAT
TGCCATCCCCGCCATCATCGCCCTCGCCACCGTCGTCATGATGTTTATTGCCTGGAAGCTCTACCAGGAGTTTGC
CTGGGACATCCTCAAGAACATCGGCGCCGACTACCGCATGAAGAAGCGCTTCCTGCACTACCAGGTCAATTGCTG
CCCGCTCCCCGCCGAGGACCCTCGTCGGGCCGCGTGCTGACTGCCCGCCAGATCTACATTGCCCTGCTCAAGTTC
GATTTCTTCTTCTTCCTCGGCTTCATCATCCAGTTCGTCGTCGTCGTCGCCCAGAAGTCGGACCCCGAGTTCGCC
CTGACCATTGCCACCATCCCCATCACCATCGGCATCCTGCTCGCCGCCGCCTACTTCACCCGCCGGGAGAACAAG
GCCGGCATGATGGTCATCATCATCCTCTACCTCGGCGGCCTCACCTACTTCATCTTCAAGCTGTGCCGCATCTAC
CAGCCCGAGTACCAGGAATCCTACAAGGCCGTGCGCAAGTCCCTCACCGCCTTCGCCGTCATCACCATCCTCCTC
ATCCTCCTCACCATCATCAACGCCATCATCTGCATGCGCAACTTCGACAAGGGGCTCAAGGCACACCTGCTGTCC
TCGCGGCGAGTGGAAGAGAAGCCCGACGCCCACTCCATCAGTCTGCACGACGTCAAGCCCCAGCTGCCCAGCCGC
ATGACCATCGACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail