Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10943
Gene name
LocationContig_93:35873..37320
Strand+
Gene length (bp)1447
Transcript length (bp)1305
Coding sequence length (bp)1305
Protein length (aa) 435

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10607 CLTH CTLH/CRA C-terminal to LisH motif domain 1.6E-31 189 341
PF13445 zf-RING_UBOX RING-type zinc-finger 4.3E-09 379 418

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GLP4|RMD5A_XENLA Protein RMD5 homolog A OS=Xenopus laevis GN=rmnd5a PE=2 SV=1 49 434 3.0E-59
sp|Q80YQ8|RMD5A_MOUSE Protein RMD5 homolog A OS=Mus musculus GN=Rmnd5a PE=1 SV=2 53 434 2.0E-58
sp|Q9H871|RMD5A_HUMAN Protein RMD5 homolog A OS=Homo sapiens GN=RMND5A PE=1 SV=1 53 434 2.0E-58
sp|Q640V2|RMD5A_XENTR Protein RMD5 homolog A OS=Xenopus tropicalis GN=rmnd5a PE=2 SV=1 49 434 3.0E-57
sp|Q91YQ7|RMD5B_MOUSE Protein RMD5 homolog B OS=Mus musculus GN=Rmnd5b PE=2 SV=1 59 434 6.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GLP4|RMD5A_XENLA Protein RMD5 homolog A OS=Xenopus laevis GN=rmnd5a PE=2 SV=1 49 434 3.0E-59
sp|Q80YQ8|RMD5A_MOUSE Protein RMD5 homolog A OS=Mus musculus GN=Rmnd5a PE=1 SV=2 53 434 2.0E-58
sp|Q9H871|RMD5A_HUMAN Protein RMD5 homolog A OS=Homo sapiens GN=RMND5A PE=1 SV=1 53 434 2.0E-58
sp|Q640V2|RMD5A_XENTR Protein RMD5 homolog A OS=Xenopus tropicalis GN=rmnd5a PE=2 SV=1 49 434 3.0E-57
sp|Q91YQ7|RMD5B_MOUSE Protein RMD5 homolog B OS=Mus musculus GN=Rmnd5b PE=2 SV=1 59 434 6.0E-55
sp|Q96G75|RMD5B_HUMAN Protein RMD5 homolog B OS=Homo sapiens GN=RMND5B PE=1 SV=1 59 434 2.0E-54
sp|O59668|YB83_SCHPO LisH domain-containing protein C29A3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A3.03c PE=3 SV=1 189 434 1.0E-51
sp|Q12508|RMD5_YEAST Sporulation protein RMD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD5 PE=3 SV=1 299 434 6.0E-25
sp|Q5RKJ1|MAEA_RAT Macrophage erythroblast attacher OS=Rattus norvegicus GN=Maea PE=2 SV=2 199 432 6.0E-13
sp|Q4VC33|MAEA_MOUSE Macrophage erythroblast attacher OS=Mus musculus GN=Maea PE=1 SV=1 199 432 6.0E-13
sp|Q7L5Y9|MAEA_HUMAN Macrophage erythroblast attacher OS=Homo sapiens GN=MAEA PE=1 SV=1 199 432 1.0E-12
sp|Q4R9A8|MAEA_MACFA Macrophage erythroblast attacher OS=Macaca fascicularis GN=MAEA PE=2 SV=1 199 432 1.0E-12
sp|Q5R532|MAEA_PONAB Macrophage erythroblast attacher OS=Pongo abelii GN=MAEA PE=2 SV=1 199 432 1.0E-12
sp|Q7SXR3|MAEA_DANRE Macrophage erythroblast attacher OS=Danio rerio GN=maea PE=2 SV=2 199 418 5.0E-12
sp|Q5F398|MAEA_CHICK Macrophage erythroblast attacher OS=Gallus gallus GN=MAEA PE=2 SV=1 199 418 2.0E-11
sp|Q6GR10|MAEA_XENLA Macrophage erythroblast attacher OS=Xenopus laevis GN=maea PE=2 SV=2 199 418 3.0E-11
sp|Q3MHJ2|MAEA_BOVIN Macrophage erythroblast attacher OS=Bos taurus GN=MAEA PE=2 SV=1 223 432 2.0E-10
sp|Q6C435|FYV10_YARLI Protein FYV10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FYV10 PE=3 SV=1 199 338 2.0E-08
sp|Q5AS80|FYV10_EMENI Protein fyv10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fyv10 PE=3 SV=2 189 347 1.0E-07
sp|Q2H991|FYV10_CHAGB Protein FYV10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FYV10 PE=3 SV=1 187 338 2.0E-07
sp|A1CZJ5|FYV10_NEOFI Protein fyv10 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fyv10 PE=3 SV=2 187 347 2.0E-06
sp|Q7S2X0|FYV10_NEUCR Protein fyv-10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fyv-10 PE=3 SV=1 189 338 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10943
MAGLEEDAPSPFAPLLAELARMRKSNLSAAIADVDAITDLLCKVREQVAGDVDAHRTGMVMTTLQNPVKAQLESV
TSDLKDVTKAQKGLGKSLDKALPQRELPMETDAMADHPTLINRATAMHLLREGQFSVASTFLREEQEQGQAEGSA
SASGSASRTDEDGDDDMRREEERDDDDMQSLSEDLQDRFSEMYGILAQLKQRNLTPAIEWARVNNGRLEAKGSNL
EFELCKLQYVWLFKGPAQNGLPDDENNGRGGALAYARRYFARFQSRHLKEIQQLSCAMIYAPNLEASPYRHIFEI
DSAFEDVATSFTREFCSLLGLSAESPLYVAVTAGAIALPRLIKYTAYMREKKTEWTTENELAFETPLPESMIYHP
IFVCPVSKEQTTEQNPAMMLPCGHVICRDSLHKIAKGSRYKCPYCPTEGHLRDAMEITF*
Coding >Hirsu2|10943
ATGGCCGGACTCGAGGAGGATGCCCCGTCGCCCTTTGCGCCCCTGCTGGCGGAGCTGGCCCGGATGAGGAAGTCG
AACCTCTCGGCCGCCATCGCTGACGTAGATGCAATCACCGACCTCCTCTGCAAGGTGCGGGAGCAAGTCGCCGGA
GATGTCGACGCCCACAGGACCGGCATGGTGATGACGACGCTGCAGAACCCGGTCAAGGCCCAGCTGGAATCCGTC
ACCAGCGACCTGAAAGACGTGACCAAGGCTCAGAAGGGCCTGGGGAAATCGCTGGACAAGGCGCTCCCGCAGCGA
GAGCTCCCCATGGAGACGGACGCGATGGCCGACCACCCCACGCTCATCAACCGGGCCACAGCCATGCACCTGCTG
CGGGAGGGCCAGTTCTCGGTCGCGTCGACCTTTTTGCGGGAGGAGCAGGAGCAGGGCCAGGCGGAGGGATCGGCG
TCGGCATCGGGGTCGGCGTCGCGGACGGACGAGGACGGCGACGACGACATGAGACGAGAGGAGGAGCGCGACGAC
GACGACATGCAGAGCCTGTCGGAGGACCTGCAGGACCGCTTCTCGGAGATGTACGGGATCCTGGCGCAGCTCAAG
CAGCGCAACCTGACGCCGGCGATCGAGTGGGCGCGGGTCAACAACGGGCGGCTCGAGGCCAAGGGCAGCAACCTC
GAGTTCGAGCTGTGCAAGCTGCAGTACGTCTGGCTCTTCAAGGGCCCGGCGCAGAACGGGCTGCCGGACGACGAG
AACAACGGGCGGGGCGGGGCGCTGGCGTACGCGCGGCGGTACTTTGCGCGCTTCCAGTCGCGGCACCTCAAGGAG
ATACAGCAGCTGTCGTGCGCCATGATCTACGCGCCCAACCTGGAGGCGTCGCCGTACCGGCACATCTTCGAGATC
GACTCGGCCTTTGAGGACGTGGCGACGTCGTTCACGCGCGAGTTCTGCTCGCTGCTCGGCCTGTCGGCCGAGTCG
CCGCTGTACGTGGCCGTGACGGCCGGCGCCATCGCGCTGCCGCGCCTCATCAAGTACACGGCCTACATGCGCGAG
AAGAAGACGGAGTGGACGACGGAGAACGAGCTGGCGTTCGAGACGCCGCTGCCCGAGTCCATGATCTACCACCCC
ATCTTCGTCTGCCCCGTCAGCAAGGAGCAGACGACGGAGCAGAACCCGGCCATGATGCTGCCCTGCGGCCACGTC
ATCTGCCGCGACAGCCTGCACAAGATCGCAAAGGGCTCGCGCTACAAGTGCCCCTACTGCCCGACCGAGGGCCAC
CTGCGCGACGCCATGGAGATTACCTTTTGA
Transcript >Hirsu2|10943
ATGGCCGGACTCGAGGAGGATGCCCCGTCGCCCTTTGCGCCCCTGCTGGCGGAGCTGGCCCGGATGAGGAAGTCG
AACCTCTCGGCCGCCATCGCTGACGTAGATGCAATCACCGACCTCCTCTGCAAGGTGCGGGAGCAAGTCGCCGGA
GATGTCGACGCCCACAGGACCGGCATGGTGATGACGACGCTGCAGAACCCGGTCAAGGCCCAGCTGGAATCCGTC
ACCAGCGACCTGAAAGACGTGACCAAGGCTCAGAAGGGCCTGGGGAAATCGCTGGACAAGGCGCTCCCGCAGCGA
GAGCTCCCCATGGAGACGGACGCGATGGCCGACCACCCCACGCTCATCAACCGGGCCACAGCCATGCACCTGCTG
CGGGAGGGCCAGTTCTCGGTCGCGTCGACCTTTTTGCGGGAGGAGCAGGAGCAGGGCCAGGCGGAGGGATCGGCG
TCGGCATCGGGGTCGGCGTCGCGGACGGACGAGGACGGCGACGACGACATGAGACGAGAGGAGGAGCGCGACGAC
GACGACATGCAGAGCCTGTCGGAGGACCTGCAGGACCGCTTCTCGGAGATGTACGGGATCCTGGCGCAGCTCAAG
CAGCGCAACCTGACGCCGGCGATCGAGTGGGCGCGGGTCAACAACGGGCGGCTCGAGGCCAAGGGCAGCAACCTC
GAGTTCGAGCTGTGCAAGCTGCAGTACGTCTGGCTCTTCAAGGGCCCGGCGCAGAACGGGCTGCCGGACGACGAG
AACAACGGGCGGGGCGGGGCGCTGGCGTACGCGCGGCGGTACTTTGCGCGCTTCCAGTCGCGGCACCTCAAGGAG
ATACAGCAGCTGTCGTGCGCCATGATCTACGCGCCCAACCTGGAGGCGTCGCCGTACCGGCACATCTTCGAGATC
GACTCGGCCTTTGAGGACGTGGCGACGTCGTTCACGCGCGAGTTCTGCTCGCTGCTCGGCCTGTCGGCCGAGTCG
CCGCTGTACGTGGCCGTGACGGCCGGCGCCATCGCGCTGCCGCGCCTCATCAAGTACACGGCCTACATGCGCGAG
AAGAAGACGGAGTGGACGACGGAGAACGAGCTGGCGTTCGAGACGCCGCTGCCCGAGTCCATGATCTACCACCCC
ATCTTCGTCTGCCCCGTCAGCAAGGAGCAGACGACGGAGCAGAACCCGGCCATGATGCTGCCCTGCGGCCACGTC
ATCTGCCGCGACAGCCTGCACAAGATCGCAAAGGGCTCGCGCTACAAGTGCCCCTACTGCCCGACCGAGGGCCAC
CTGCGCGACGCCATGGAGATTACCTTTTGA
Gene >Hirsu2|10943
ATGGCCGGACTCGAGGAGGATGCCCCGTCGCCCTTTGCGCCCCTGCTGGCGGAGCTGGCCCGGATGAGGAAGTCG
AACCTCTCGGCCGCCATCGCTGACGTAGATGCAATCACCGACCTCCTCTGCAAGGTGCGGGAGCAAGTCGCCGGA
GGTAGGCATGCACCCCCCCCCCCCCCCCCTCGACCGCTGGTGCAAGTTCCAGCCTGACACGCCCAGATGTCGACG
CCCACAGGACCGGCATGGTGATGACGACGCTGCAGAACCCGGTCAAGGCCCAGCTGGAATCCGTCACCAGCGACC
TGAAAGACGTGACCAAGGCTCAGAAGGGCCTGGGGAAATCGCTGGACAAGGTACGTTCGTTCGTCCGTTCCGATC
CGCGCCACCGACGTCGGCGCGGTGCTGACCTCGACACCGCCCCCCTCCACAGGCGCTCCCGCAGCGAGAGCTCCC
CATGGAGACGGACGCGATGGCCGACCACCCCACGCTCATCAACCGGGCCACAGCCATGCACCTGCTGCGGGAGGG
CCAGTTCTCGGTCGCGTCGACCTTTTTGCGGGAGGAGCAGGAGCAGGGCCAGGCGGAGGGATCGGCGTCGGCATC
GGGGTCGGCGTCGCGGACGGACGAGGACGGCGACGACGACATGAGACGAGAGGAGGAGCGCGACGACGACGACAT
GCAGAGCCTGTCGGAGGACCTGCAGGACCGCTTCTCGGAGATGTACGGGATCCTGGCGCAGCTCAAGCAGCGCAA
CCTGACGCCGGCGATCGAGTGGGCGCGGGTCAACAACGGGCGGCTCGAGGCCAAGGGCAGCAACCTCGAGTTCGA
GCTGTGCAAGCTGCAGTACGTCTGGCTCTTCAAGGGCCCGGCGCAGAACGGGCTGCCGGACGACGAGAACAACGG
GCGGGGCGGGGCGCTGGCGTACGCGCGGCGGTACTTTGCGCGCTTCCAGTCGCGGCACCTCAAGGAGATACAGCA
GCTGTCGTGCGCCATGATCTACGCGCCCAACCTGGAGGCGTCGCCGTACCGGCACATCTTCGAGATCGACTCGGC
CTTTGAGGACGTGGCGACGTCGTTCACGCGCGAGTTCTGCTCGCTGCTCGGCCTGTCGGCCGAGTCGCCGCTGTA
CGTGGCCGTGACGGCCGGCGCCATCGCGCTGCCGCGCCTCATCAAGTACACGGCCTACATGCGCGAGAAGAAGAC
GGAGTGGACGACGGAGAACGAGCTGGCGTTCGAGACGCCGCTGCCCGAGTCCATGATCTACCACCCCATCTTCGT
CTGCCCCGTCAGCAAGGAGCAGACGACGGAGCAGAACCCGGCCATGATGCTGCCCTGCGGCCACGTCATCTGCCG
CGACAGCCTGCACAAGATCGCAAAGGGCTCGCGCTACAAGTGCCCCTACTGCCCGACCGAGGGCCACCTGCGCGA
CGCCATGGAGATTACCTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail