Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10936
Gene name
LocationContig_93:14808..16932
Strand-
Gene length (bp)2124
Transcript length (bp)1599
Coding sequence length (bp)1599
Protein length (aa) 533

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.5E-30 63 471
PF00083 Sugar_tr Sugar (and other) transporter 1.7E-06 99 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 5 526 2.0E-64
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 11 512 4.0E-47
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 45 514 3.0E-16
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 26 471 1.0E-15
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 309 495 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 5 526 2.0E-64
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 11 512 4.0E-47
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 45 514 3.0E-16
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 26 471 1.0E-15
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 309 495 1.0E-14
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 20 521 2.0E-14
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 16 472 1.0E-13
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 39 448 2.0E-13
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 39 448 3.0E-13
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 31 464 2.0E-12
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 25 512 3.0E-11
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 34 451 1.0E-10
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 104 448 4.0E-10
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 25 471 2.0E-09
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 44 513 2.0E-09
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 309 491 2.0E-09
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 44 513 3.0E-09
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 44 513 4.0E-09
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 25 513 4.0E-08
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 30 513 5.0E-08
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 43 522 6.0E-08
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 43 522 7.0E-08
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 44 219 2.0E-07
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 118 215 1.0E-06
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 14 451 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 59 81 22
2 101 118 17
3 125 144 19
4 186 208 22
5 215 234 19
6 315 337 22
7 349 371 22
8 391 413 22
9 420 442 22
10 452 474 22
11 486 508 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10936
MTDYQPNAVIHPPGTVELISQYTTDDQPFEPDPDALLLCPTPSDDPNDPLRWSTLRKSWNYGLLIAMTISVFSVL
SIQPVFWSQMLEEMHVTQEDLNNAQAAQLVGLAVGCIIFIPIAKKYGRRPVYIISTLIVAGATWWSAFMDSARDV
ILTNVLAGLAGATNETAVQMSIRDLYFVHQRGSANGIYLVAVTAGAFLTPMAAGAQALYSGWRSSYITLACFMTG
LTILFAISFEETKFVPPPERGPDIEISDDASIRKGYPIDVKSMTAAESEDPTRARRTHFRLQLITKTDESIWKTI
YYPIFTSWYPHVVFTYLEFASGIAWVVMVSAITSIVFSKAPYDFNPLQVGFMFGGTLIGSVFGSLYGGMLVDWAI
VKFAKRNRGLFEPEMRLWLMPLPAIAMSLGLAVFGITADRGMHWVFPSIGGGVFAFGFGAISDITFTLVIDSFPN
LVAQTFVIIAFFRNALSIVGPFSITPWMEAMSISAIFVVAGSISLSIHVFAVPLAIWGKRTRASIAPQYYRLTEK
LYPEMVA*
Coding >Hirsu2|10936
ATGACCGACTATCAGCCGAACGCTGTCATCCATCCGCCGGGGACTGTCGAGTTGATCTCTCAGTACACCACCGAC
GACCAGCCGTTCGAGCCCGATCCGGATGCCCTGCTTCTATGTCCGACTCCTTCGGATGACCCGAATGACCCCTTG
AGGTGGTCGACTCTCCGCAAGTCTTGGAACTACGGCCTGCTCATCGCCATGACCATATCCGTCTTCTCTGTACTC
TCCATCCAGCCCGTCTTCTGGTCTCAGATGCTTGAAGAGATGCATGTCACGCAAGAGGACCTCAACAACGCCCAA
GCCGCTCAGCTAGTCGGCCTGGCCGTCGGGTGCATCATCTTCATCCCGATTGCCAAAAAGTACGGCCGACGTCCG
GTCTACATCATCTCGACTCTCATCGTCGCCGGTGCTACCTGGTGGTCAGCCTTCATGGATTCGGCGAGGGATGTG
ATCCTAACCAATGTCCTTGCTGGCCTGGCCGGTGCCACCAACGAAACGGCCGTTCAGATGAGCATTCGCGACCTA
TACTTCGTCCACCAGAGAGGTTCCGCCAACGGAATCTACTTGGTGGCCGTCACCGCTGGAGCCTTCCTTACTCCC
ATGGCTGCTGGCGCCCAGGCACTCTATTCGGGCTGGCGCTCGTCTTACATCACGCTTGCCTGCTTCATGACGGGC
TTGACGATCCTCTTCGCCATTTCGTTCGAGGAGACGAAATTCGTGCCTCCCCCGGAGAGGGGCCCGGATATCGAG
ATTAGCGACGACGCCAGCATTCGGAAGGGATACCCGATAGACGTCAAGTCGATGACCGCGGCCGAGTCTGAGGAC
CCAACTCGTGCCCGCCGAACCCACTTCAGGCTTCAACTCATCACCAAGACGGACGAGTCCATCTGGAAGACTATC
TACTACCCCATATTCACCTCCTGGTATCCTCACGTCGTCTTCACCTATCTCGAGTTCGCATCCGGCATTGCCTGG
GTTGTCATGGTCTCCGCCATCACCTCCATCGTCTTTTCAAAAGCGCCGTACGACTTTAATCCTCTCCAGGTCGGC
TTCATGTTTGGAGGCACCTTGATTGGCTCCGTCTTCGGCAGTCTGTACGGCGGGATGCTTGTGGATTGGGCCATT
GTGAAGTTCGCGAAGCGGAACCGAGGCCTCTTCGAGCCCGAAATGCGCCTTTGGCTCATGCCTCTCCCGGCCATC
GCCATGTCGCTCGGGCTCGCCGTCTTCGGCATCACCGCCGACCGGGGCATGCACTGGGTATTCCCCAGCATCGGC
GGCGGCGTGTTCGCGTTTGGATTTGGCGCAATTTCGGACATCACCTTTACTCTCGTTATCGATTCCTTTCCCAAC
CTCGTCGCGCAAACTTTCGTCATCATTGCCTTCTTCCGCAACGCACTCAGCATCGTCGGCCCGTTTTCCATCACT
CCCTGGATGGAAGCCATGAGTATCAGCGCCATCTTCGTTGTGGCCGGGTCCATCAGTCTGAGCATCCACGTTTTT
GCCGTGCCGCTTGCTATCTGGGGCAAGAGAACGAGAGCTAGCATCGCGCCTCAGTACTATCGACTGACGGAGAAG
TTGTACCCGGAGATGGTGGCCTAG
Transcript >Hirsu2|10936
ATGACCGACTATCAGCCGAACGCTGTCATCCATCCGCCGGGGACTGTCGAGTTGATCTCTCAGTACACCACCGAC
GACCAGCCGTTCGAGCCCGATCCGGATGCCCTGCTTCTATGTCCGACTCCTTCGGATGACCCGAATGACCCCTTG
AGGTGGTCGACTCTCCGCAAGTCTTGGAACTACGGCCTGCTCATCGCCATGACCATATCCGTCTTCTCTGTACTC
TCCATCCAGCCCGTCTTCTGGTCTCAGATGCTTGAAGAGATGCATGTCACGCAAGAGGACCTCAACAACGCCCAA
GCCGCTCAGCTAGTCGGCCTGGCCGTCGGGTGCATCATCTTCATCCCGATTGCCAAAAAGTACGGCCGACGTCCG
GTCTACATCATCTCGACTCTCATCGTCGCCGGTGCTACCTGGTGGTCAGCCTTCATGGATTCGGCGAGGGATGTG
ATCCTAACCAATGTCCTTGCTGGCCTGGCCGGTGCCACCAACGAAACGGCCGTTCAGATGAGCATTCGCGACCTA
TACTTCGTCCACCAGAGAGGTTCCGCCAACGGAATCTACTTGGTGGCCGTCACCGCTGGAGCCTTCCTTACTCCC
ATGGCTGCTGGCGCCCAGGCACTCTATTCGGGCTGGCGCTCGTCTTACATCACGCTTGCCTGCTTCATGACGGGC
TTGACGATCCTCTTCGCCATTTCGTTCGAGGAGACGAAATTCGTGCCTCCCCCGGAGAGGGGCCCGGATATCGAG
ATTAGCGACGACGCCAGCATTCGGAAGGGATACCCGATAGACGTCAAGTCGATGACCGCGGCCGAGTCTGAGGAC
CCAACTCGTGCCCGCCGAACCCACTTCAGGCTTCAACTCATCACCAAGACGGACGAGTCCATCTGGAAGACTATC
TACTACCCCATATTCACCTCCTGGTATCCTCACGTCGTCTTCACCTATCTCGAGTTCGCATCCGGCATTGCCTGG
GTTGTCATGGTCTCCGCCATCACCTCCATCGTCTTTTCAAAAGCGCCGTACGACTTTAATCCTCTCCAGGTCGGC
TTCATGTTTGGAGGCACCTTGATTGGCTCCGTCTTCGGCAGTCTGTACGGCGGGATGCTTGTGGATTGGGCCATT
GTGAAGTTCGCGAAGCGGAACCGAGGCCTCTTCGAGCCCGAAATGCGCCTTTGGCTCATGCCTCTCCCGGCCATC
GCCATGTCGCTCGGGCTCGCCGTCTTCGGCATCACCGCCGACCGGGGCATGCACTGGGTATTCCCCAGCATCGGC
GGCGGCGTGTTCGCGTTTGGATTTGGCGCAATTTCGGACATCACCTTTACTCTCGTTATCGATTCCTTTCCCAAC
CTCGTCGCGCAAACTTTCGTCATCATTGCCTTCTTCCGCAACGCACTCAGCATCGTCGGCCCGTTTTCCATCACT
CCCTGGATGGAAGCCATGAGTATCAGCGCCATCTTCGTTGTGGCCGGGTCCATCAGTCTGAGCATCCACGTTTTT
GCCGTGCCGCTTGCTATCTGGGGCAAGAGAACGAGAGCTAGCATCGCGCCTCAGTACTATCGACTGACGGAGAAG
TTGTACCCGGAGATGGTGGCCTAG
Gene >Hirsu2|10936
ATGACCGACTATCAGCCGAACGCTGTCATCCATCCGCCGGGGACTGTCGAGTTGATCTCTCGTACGTAGTCTATC
TGCCTCTGGATCCGGCTCTCTGACCTGCTCTTTTACCCTGCTCGGCCGACGAGCACTGGTTCCGTGTCCATGTCG
TTGTGCGCTGACCGTGATGCCCTCTCCCCAGAGTACACCACCGACGACCAGCCGTTCGAGCCCGATCCGGATGCC
CTGCTTCTATGTCCGACTCCTTCGGATGACCCGAATGACCCCTTGGTCGGTAGAGGACCCTCTTCGCCTCTTCTC
CGTCGATCCGGAGGCTCATGTGTACTAGAGGTGGTCGACTCTCCGCAAGTCTTGGAACTACGGCCTGCTCATCGC
CATGACCATATCCGTCTTCTCTGTGTGAGTACATGTTTTGCCGGACCCGAGACGCAAATTCATGACCGTCCTCTA
ACCAGCTATGACCTGCAGACTCTCCATCCAGCCCGTCTTCTGGTCTCAGATGCTTGAAGAGATGCATGTCACGCA
AGAGGACCTCAACAACGCCCAAGCCGCTCAGCTAGTCGGCCTGGCCGTCGGGTGCATCATCTTCATCCCGATTGC
CAAAAAGTACGGCCGACGTCCGGTCTACATCATCTCGACTCTCATCGTCGCCGGTGCTACCTGGTGGTCAGCCTT
CATGGATTCGGCGAGGGATGTGATCCTAACCAATGTCCTTGCTGGCCTGGCCGGTGCCACCAACGAAACGGCCGT
TCAGATGAGCGTACGCATACCCTCGACTGCGTCATTCCACGCACCATCATCCAACGACATCGCCCGCCCACCGCT
TGGTTCATGCTTTCATCAGCGAATCATAGGCTGACTCCGTTTTCTTGCAACGATAAGATTCGCGACCTATACTTC
GTCCACCAGAGAGGTTCCGCCAACGGAATCTACTTGGTGGCCGTCACCGCTGGAGCCTTCCTTACTCCCATGGCT
GCTGGCGCCCAGGCACTCTATTCGGGCTGGCGCTCGTCTTACATCACGCTTGCCTGCTTCATGACGGGCTTGACG
ATCCTCTTCGCCATTTCGTTCGAGGAGACGAAATTCGTGCCTCCCCCGGAGAGGGGCCCGGATATCGAGATTAGC
GACGACGCCAGCATTCGGAAGGGATACCCGATAGACGTCAAGTCGATGACCGCGGCCGAGTCTGAGGACCCAACT
CGTGCCCGCCGAACCCACTTCAGGCTTCAACTCATCACCAAGACGGACGAGTCCATCTGGAAGACTATCTACTAC
CCCATATTCACCTCCTGGTATCCTCACGTCGTCTTCACCTATCTCGAGTTCGCATCCGGCATTGCCTGGGTTGTC
ATGGTCTCCGCCATCACCTCCATCGTCTTTTCAAAAGCGCCGTACGACTTTAATCCTCTCCAGGTCGGCTTCATG
TTTGGAGGCACCTTGATTGGCTCCGTCTTCGGCAGTCTGTACGGCGGGATGCTTGTGGATTGGGCCATTGTGAAG
TTCGCGAAGCGGAACCGAGGCCTCTTCGAGCCCGAAATGCGCCTTTGGCTCATGCCTCTCCCGGCCATCGCCATG
TCGCTCGGGCTCGCCGTCTTCGGCATCACCGCCGACCGGGTATGCACCCCAGCTTGTCCCCGGCCCTGCCTATGG
AACGACTCGACGAATGCTGACCGGGCGGAATCTCCAGGGCATGCACTGGGTATTCCCCAGCATCGGCGGCGGCGT
GTTCGCGTTTGGATTTGGCGCAATTTCGGACATCACCTTTACTCTCGTTATCGATTCCTTTCCCAACGTAAGGAC
GTGCCAGCCAGGGCCCTCTTTCATTGTCGCGAATACGATTGATGGGTACACTACGCTAACGATGCTCCTCACCAG
CTCGTCGCGCAAACTTTCGTCATCATTGCCTTCTTCCGCAACGCACTCAGCATCGTCGGCCCGTTTTCCATCACT
CCCTGGATGGAAGCCATGAGTATCAGCGCCATCTTCGTTGTGGCCGGGTCCATCAGTCTGAGCATCCACGTTTTT
GCCGTGCCGCTTGCTATCTGGGGCAAGAGAACGAGAGCTAGCATCGCGCCTCAGTACTATCGACTGACGGAGAAG
TTGTACCCGGAGATGGTGGCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail