Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10935
Gene name
LocationContig_93:13535..14250
Strand+
Gene length (bp)715
Transcript length (bp)663
Coding sequence length (bp)663
Protein length (aa) 221

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0879 0.0708 0.9306 0.0548 0.0778 0.0322 0.133 0.2328 0.1734 0.0036

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999345

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7480
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|10935 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10935
MKTIGLFILTGSLMSQASPTQGTLNVRDVSNGTRDAWSTKVAHPPSMLCGGELHLMYQDAAYLRRLVWTKDAKDV
RQDCDDRSLRALNYCRMYPSGPPANPNFGRSCVYFALEAYKACESAQGVDEPKVFTNLEDRIIGAREECHKHFQK
CEKLKESTLDHDKCLDSEGFSAMSCYLEKANPDGSQECLAPFSKSGMACRKSTDFNLCMDKAVRDSAQAC*
Coding >Hirsu2|10935
ATGAAGACTATCGGTCTTTTCATCCTGACGGGCTCCCTGATGTCCCAGGCCTCTCCTACCCAGGGGACTCTTAAT
GTGCGCGACGTATCTAACGGCACCAGAGACGCATGGTCAACCAAGGTCGCACATCCTCCTTCCATGCTATGCGGT
GGCGAGCTGCATTTGATGTACCAAGACGCTGCGTACCTTCGCCGTCTCGTCTGGACCAAGGACGCCAAGGACGTT
CGCCAGGACTGCGACGACCGTAGCCTCCGGGCTCTCAACTATTGTCGCATGTATCCGAGCGGTCCCCCTGCTAAC
CCAAACTTTGGCCGTTCCTGCGTCTATTTCGCTTTGGAGGCTTACAAGGCCTGCGAAAGTGCGCAGGGAGTCGAC
GAGCCAAAGGTGTTTACGAACTTGGAAGACCGGATTATCGGCGCCCGGGAGGAATGCCATAAGCATTTTCAGAAA
TGCGAAAAACTTAAAGAGAGCACGCTCGACCATGATAAATGCCTGGACTCGGAAGGGTTTTCGGCGATGAGCTGT
TACTTGGAAAAGGCTAATCCGGACGGGTCACAGGAGTGCTTGGCACCATTCTCGAAATCGGGAATGGCTTGTCGT
AAATCGACGGATTTCAATCTCTGTATGGATAAAGCCGTCCGTGACAGTGCTCAGGCCTGCTAG
Transcript >Hirsu2|10935
ATGAAGACTATCGGTCTTTTCATCCTGACGGGCTCCCTGATGTCCCAGGCCTCTCCTACCCAGGGGACTCTTAAT
GTGCGCGACGTATCTAACGGCACCAGAGACGCATGGTCAACCAAGGTCGCACATCCTCCTTCCATGCTATGCGGT
GGCGAGCTGCATTTGATGTACCAAGACGCTGCGTACCTTCGCCGTCTCGTCTGGACCAAGGACGCCAAGGACGTT
CGCCAGGACTGCGACGACCGTAGCCTCCGGGCTCTCAACTATTGTCGCATGTATCCGAGCGGTCCCCCTGCTAAC
CCAAACTTTGGCCGTTCCTGCGTCTATTTCGCTTTGGAGGCTTACAAGGCCTGCGAAAGTGCGCAGGGAGTCGAC
GAGCCAAAGGTGTTTACGAACTTGGAAGACCGGATTATCGGCGCCCGGGAGGAATGCCATAAGCATTTTCAGAAA
TGCGAAAAACTTAAAGAGAGCACGCTCGACCATGATAAATGCCTGGACTCGGAAGGGTTTTCGGCGATGAGCTGT
TACTTGGAAAAGGCTAATCCGGACGGGTCACAGGAGTGCTTGGCACCATTCTCGAAATCGGGAATGGCTTGTCGT
AAATCGACGGATTTCAATCTCTGTATGGATAAAGCCGTCCGTGACAGTGCTCAGGCCTGCTAG
Gene >Hirsu2|10935
ATGAAGACTATCGGTCTTTTCATCCTGACGGGCTCCCTGATGTCCCAGGCCTCTCCTACCCAGGGGACTCTTAAT
GTGCGCGACGTATCTAACGGCACCAGAGACGCATGTACAGTACGGCACCCTATCCCTTCACCTCGGAGCTGCGTC
TTGCTGACTAGGGTCAACCAAGGTCGCACATCCTCCTTCCATGCTATGCGGTGGCGAGCTGCATTTGATGTACCA
AGACGCTGCGTACCTTCGCCGTCTCGTCTGGACCAAGGACGCCAAGGACGTTCGCCAGGACTGCGACGACCGTAG
CCTCCGGGCTCTCAACTATTGTCGCATGTATCCGAGCGGTCCCCCTGCTAACCCAAACTTTGGCCGTTCCTGCGT
CTATTTCGCTTTGGAGGCTTACAAGGCCTGCGAAAGTGCGCAGGGAGTCGACGAGCCAAAGGTGTTTACGAACTT
GGAAGACCGGATTATCGGCGCCCGGGAGGAATGCCATAAGCATTTTCAGAAATGCGAAAAACTTAAAGAGAGCAC
GCTCGACCATGATAAATGCCTGGACTCGGAAGGGTTTTCGGCGATGAGCTGTTACTTGGAAAAGGCTAATCCGGA
CGGGTCACAGGAGTGCTTGGCACCATTCTCGAAATCGGGAATGGCTTGTCGTAAATCGACGGATTTCAATCTCTG
TATGGATAAAGCCGTCCGTGACAGTGCTCAGGCCTGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail