Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10929
Gene name
LocationContig_929:2780..5051
Strand-
Gene length (bp)2271
Transcript length (bp)1995
Coding sequence length (bp)1995
Protein length (aa) 665

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 4.9E-89 125 576
PF07690 MFS_1 Major Facilitator Superfamily 1.8E-09 161 398

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 125 576 2.0E-49
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 118 577 4.0E-47
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 118 577 7.0E-47
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 119 576 8.0E-46
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 121 573 8.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 125 576 2.0E-49
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 118 577 4.0E-47
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 118 577 7.0E-47
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 119 576 8.0E-46
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 121 573 8.0E-43
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 128 573 1.0E-42
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 125 576 1.0E-42
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 177 573 3.0E-41
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 177 573 3.0E-41
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 177 573 3.0E-41
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 135 576 8.0E-40
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 124 576 1.0E-39
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 182 573 3.0E-39
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 182 573 3.0E-39
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 111 576 5.0E-38
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 115 621 8.0E-38
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 187 575 5.0E-37
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 70 620 3.0E-36
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 174 592 4.0E-36
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 174 592 4.0E-36
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 177 576 6.0E-36
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 160 592 2.0E-35
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 160 592 4.0E-35
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 177 576 7.0E-35
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 122 600 1.0E-34
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 177 576 1.0E-34
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 177 573 2.0E-34
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 125 572 2.0E-34
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 177 575 2.0E-34
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 179 576 3.0E-34
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 186 581 3.0E-34
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 116 600 3.0E-34
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 125 572 7.0E-34
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 125 572 8.0E-34
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 125 572 8.0E-34
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 125 576 8.0E-34
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 160 576 8.0E-34
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 125 572 1.0E-33
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 95 600 1.0E-33
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 189 576 3.0E-33
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 186 573 1.0E-32
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 90 609 1.0E-32
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 173 582 1.0E-32
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 117 579 2.0E-32
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 115 628 2.0E-32
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 81 624 2.0E-32
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 171 573 2.0E-32
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 177 577 3.0E-32
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 189 576 3.0E-32
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 189 572 5.0E-32
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 72 573 5.0E-32
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 173 582 5.0E-32
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 189 576 6.0E-32
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 177 575 7.0E-32
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 112 445 8.0E-32
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 186 573 8.0E-32
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 160 630 8.0E-32
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 91 576 9.0E-32
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 189 576 9.0E-32
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 174 619 1.0E-31
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 177 572 1.0E-31
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 117 579 1.0E-31
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 115 575 1.0E-31
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 186 573 1.0E-31
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 128 576 2.0E-31
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 160 594 2.0E-31
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 128 573 2.0E-31
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 115 576 2.0E-31
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 68 621 2.0E-31
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 95 594 2.0E-31
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 186 573 3.0E-31
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 180 573 3.0E-31
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 112 573 3.0E-31
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 128 576 4.0E-31
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 120 572 4.0E-31
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 189 576 4.0E-31
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 97 572 4.0E-31
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 95 600 4.0E-31
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 224 576 5.0E-31
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 122 573 6.0E-31
sp|P79365|GTR1_SHEEP Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) OS=Ovis aries GN=SLC2A1 PE=2 SV=1 215 572 6.0E-31
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 83 576 7.0E-31
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 97 580 7.0E-31
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 160 576 8.0E-31
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 186 573 8.0E-31
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 95 573 9.0E-31
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 186 573 1.0E-30
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 186 573 1.0E-30
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 186 573 1.0E-30
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 177 572 1.0E-30
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 128 576 1.0E-30
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 216 576 3.0E-30
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 97 578 3.0E-30
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 189 576 3.0E-30
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 95 573 3.0E-30
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 189 573 3.0E-30
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 186 573 4.0E-30
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 125 446 4.0E-30
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 95 573 5.0E-30
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 177 573 6.0E-30
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 83 455 8.0E-30
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 186 573 9.0E-30
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 192 573 1.0E-29
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 180 573 1.0E-29
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 167 576 1.0E-29
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 100 573 1.0E-29
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 173 576 2.0E-29
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 97 578 2.0E-29
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 177 572 2.0E-29
sp|Q9SFG0|STP6_ARATH Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1 120 605 3.0E-29
sp|P15729|GLCP_SYNY3 Glucose transport protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gtr PE=3 SV=2 126 572 3.0E-29
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 117 573 3.0E-29
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 117 606 3.0E-29
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 108 572 3.0E-29
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 117 573 4.0E-29
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 177 575 5.0E-29
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 165 573 6.0E-29
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 186 573 9.0E-29
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 186 629 1.0E-28
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 123 581 1.0E-28
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 186 573 1.0E-28
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 125 575 2.0E-28
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 177 573 2.0E-28
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 88 576 2.0E-28
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 122 573 2.0E-28
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 177 573 3.0E-28
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 177 575 3.0E-28
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 177 573 3.0E-28
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 160 576 4.0E-28
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 177 573 4.0E-28
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 88 576 4.0E-28
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 108 576 4.0E-28
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 70 576 5.0E-28
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 177 573 7.0E-28
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 117 576 1.0E-27
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 86 455 1.0E-27
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 97 629 1.0E-27
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 192 582 2.0E-27
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 182 576 2.0E-27
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 186 573 2.0E-27
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 86 455 2.0E-27
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 176 573 3.0E-27
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 177 576 3.0E-27
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 177 629 4.0E-27
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 187 573 4.0E-27
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 167 576 5.0E-27
sp|Q863Y9|GTR5_HORSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Equus caballus GN=SLC2A5 PE=2 SV=1 180 582 5.0E-27
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 192 582 6.0E-27
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 160 627 7.0E-27
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 167 614 8.0E-27
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 165 579 1.0E-26
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 186 576 1.0E-26
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 186 576 1.0E-26
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 177 576 1.0E-26
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 186 619 1.0E-26
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 115 575 2.0E-26
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 119 576 2.0E-26
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 186 576 2.0E-26
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 177 576 2.0E-26
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 177 576 3.0E-26
sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 177 573 3.0E-26
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 183 575 4.0E-26
sp|P58351|GTR2_BOVIN Solute carrier family 2, facilitated glucose transporter member 2 OS=Bos taurus GN=SLC2A2 PE=2 SV=2 177 515 5.0E-26
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 177 573 5.0E-26
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 119 576 6.0E-26
sp|Q5RET7|GTR5_PONAB Solute carrier family 2, facilitated glucose transporter member 5 OS=Pongo abelii GN=SLC2A5 PE=2 SV=1 180 576 7.0E-26
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 124 599 7.0E-26
sp|Q27994|GTR4_BOVIN Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus GN=SLC2A4 PE=2 SV=2 134 576 1.0E-25
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 177 576 3.0E-25
sp|O65413|STP12_ARATH Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1 120 575 4.0E-25
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 176 572 7.0E-25
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 183 577 2.0E-24
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 161 573 2.0E-24
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 86 576 3.0E-24
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 161 573 3.0E-24
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 165 573 7.0E-24
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 188 446 7.0E-24
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 83 573 8.0E-24
sp|Q9JJZ1|GTR8_RAT Solute carrier family 2, facilitated glucose transporter member 8 OS=Rattus norvegicus GN=Slc2a8 PE=1 SV=1 232 576 1.0E-23
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 186 629 1.0E-23
sp|Q9BYW1|GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens GN=SLC2A11 PE=2 SV=1 118 573 3.0E-23
sp|P19357|GTR4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus GN=Slc2a4 PE=1 SV=1 209 576 4.0E-23
sp|Q9JIF3|GTR8_MOUSE Solute carrier family 2, facilitated glucose transporter member 8 OS=Mus musculus GN=Slc2a8 PE=1 SV=2 232 576 8.0E-23
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 178 576 1.0E-22
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 117 576 2.0E-22
sp|P22732|GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens GN=SLC2A5 PE=1 SV=1 180 593 3.0E-22
sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1 134 576 3.0E-22
sp|P14142|GTR4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus GN=Slc2a4 PE=1 SV=3 209 576 4.0E-22
sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens GN=SLC2A6 PE=1 SV=2 187 585 1.0E-21
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 187 442 2.0E-21
sp|Q94KE0|ERDL3_ARATH Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1 177 573 3.0E-21
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 180 573 1.0E-20
sp|P38142|YB91_YEAST Probable metabolite transport protein YBR241C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR241C PE=1 SV=1 177 568 2.0E-20
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 118 330 3.0E-20
sp|Q9NY64|GTR8_HUMAN Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens GN=SLC2A8 PE=1 SV=3 232 576 7.0E-20
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 166 637 1.0E-19
sp|Q32NG5|GTR12_XENLA Solute carrier family 2, facilitated glucose transporter member 12 OS=Xenopus laevis GN=slc2a12 PE=2 SV=1 160 460 3.0E-19
sp|O44616|FGTH1_CAEEL Facilitated glucose transporter homolog OS=Caenorhabditis elegans GN=R09B5.11 PE=1 SV=2 177 524 4.0E-19
sp|P53142|VPS73_YEAST Vacuolar protein sorting-associated protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS73 PE=1 SV=1 112 566 6.0E-19
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 122 478 3.0E-18
sp|Q39524|HUP2_PARKE H(+)/hexose cotransporter 2 OS=Parachlorella kessleri GN=HUP2 PE=2 SV=1 120 576 3.0E-17
sp|P58354|GTR8_BOVIN Solute carrier family 2, facilitated glucose transporter member 8 OS=Bos taurus GN=SLC2A8 PE=2 SV=2 182 576 4.0E-17
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 122 328 1.0E-16
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 121 475 2.0E-16
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 369 581 2.0E-16
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 130 330 2.0E-16
sp|Q7XA64|ERDL9_ARATH Sugar transporter ERD6-like 9 OS=Arabidopsis thaliana GN=At3g05155 PE=2 SV=1 177 443 2.0E-16
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 121 458 3.0E-16
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 170 571 5.0E-16
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 121 475 5.0E-16
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 122 315 8.0E-16
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 303 574 1.0E-15
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 72 580 6.0E-15
sp|P53048|MAL11_YEAST General alpha-glucoside permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL11 PE=1 SV=1 59 583 3.0E-14
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 369 576 4.0E-14
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 173 593 7.0E-14
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 369 581 3.0E-13
sp|P15685|MAL61_YEASX Maltose permease MAL61 OS=Saccharomyces cerevisiae GN=MAL61 PE=3 SV=1 173 593 9.0E-13
sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 SV=1 173 597 1.0E-12
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 173 598 1.0E-12
sp|C8Z6M6|MPH3_YEAS8 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MPH3 PE=3 SV=1 173 598 1.0E-12
sp|A6ZX88|MPH3_YEAS7 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH3 PE=3 SV=1 173 598 1.0E-12
sp|P46408|GTR5_RABIT Solute carrier family 2, facilitated glucose transporter member 5 OS=Oryctolagus cuniculus GN=SLC2A5 PE=2 SV=1 180 572 2.0E-12
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 173 597 2.0E-12
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 474 576 8.0E-12
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 474 576 9.0E-12
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 474 576 2.0E-11
sp|Q46909|YGCS_ECOLI Inner membrane metabolite transport protein YgcS OS=Escherichia coli (strain K12) GN=ygcS PE=1 SV=2 175 565 8.0E-11
sp|A6QLW8|S22A7_BOVIN Solute carrier family 22 member 7 OS=Bos taurus GN=SLC22A7 PE=2 SV=1 134 513 1.0E-10
sp|P53403|GTR3_DROME Glucose transporter type 3 OS=Drosophila melanogaster GN=Glut3 PE=2 SV=1 191 577 3.0E-10
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 174 573 4.0E-10
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 166 581 6.0E-10
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 174 460 2.0E-08
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 478 578 2.0E-08
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 483 592 3.0E-08
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 478 576 5.0E-08
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 95 514 9.0E-08
sp|Q3YAW7|S22A7_RABIT Solute carrier family 22 member 7 OS=Oryctolagus cuniculus GN=SLC22A7 PE=2 SV=1 174 513 5.0E-07
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 187 571 7.0E-07
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 187 571 7.0E-07
sp|Q8MJI6|S22A2_RABIT Solute carrier family 22 member 2 OS=Oryctolagus cuniculus GN=SLC22A2 PE=1 SV=1 284 571 1.0E-06
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 475 576 1.0E-06
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 135 513 2.0E-06
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 173 571 2.0E-06
sp|A7MBE0|S22A1_BOVIN Solute carrier family 22 member 1 OS=Bos taurus GN=SLC22A1 PE=2 SV=1 284 571 4.0E-06
sp|Q1RPP5|S22A7_PIG Solute carrier family 22 member 7 OS=Sus scrofa GN=SLC22A7 PE=2 SV=1 170 513 5.0E-06
sp|O95528|GTR10_HUMAN Solute carrier family 2, facilitated glucose transporter member 10 OS=Homo sapiens GN=SLC2A10 PE=1 SV=2 464 576 5.0E-06
sp|Q8VHD6|GTR10_MOUSE Solute carrier family 2, facilitated glucose transporter member 10 OS=Mus musculus GN=Slc2a10 PE=2 SV=1 474 576 7.0E-06
sp|Q5R540|S22A7_PONAB Solute carrier family 22 member 7 OS=Pongo abelii GN=SLC22A7 PE=2 SV=1 170 513 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 164 186 22
2 196 218 22
3 260 281 21
4 291 313 22
5 374 396 22
6 411 433 22
7 440 462 22
8 477 499 22
9 512 534 22
10 539 561 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10929
MASDPSHGDEGSSRFHSASSAEAGRRPRGSDSYVNINANVEARIKNPLIGLPRRTLLSNVDDFCRLKGLDAHRDI
LRKGALVAQDPTGYEDITGDEALTEDEVEALRNEVLNKWRIPRLLYLTIITCSIGAAVQGWDQTGSNGANLQFPQ
ALHIGSKTIRDKILVGLVNAAPYIGTALFGCWLSDPINNYFGRRGTIFIAANFCLWPVLACAFCNTWVQLLGCRL
LLGVGMGTKASTVPIFAAENSPAPIRGALVMSWQLWNAFGIFLGTCANLICMRIGPNSWRYQLGSAFIPAVPLVI
LVYFCPESPRWYIKKNRYADAFRSLLRLRNNPIQAARDLYYIHVQLQVESEFIVHGTYIGRFFDLFTIPRVRRAT
LASFVVMIAQQMCGINIIAFYSSSVFAVGGATDFDALMATWGFGLINFLFAIPAIWTIDTFGRRTLLLFTFPQMA
WTLLAAGLCSALIPDPEKSKVHMAFVALFVYLFAAFYSPGEGPVPFTYSAEVFPLSHREVGMAWAVATCLFWAAV
LSVTFPLMLDRLAAFGSFGLYAVFNIVALVMIFLWVPETKQRTLEELDYIFGVPTRVFMKYQVTKALPWWFKRWI
LFRRDATLEPLYRLDVAENEEDEQQSTDIGFENDKARVELKDIAGFPTVRRTDEPSSGPTAPPR*
Coding >Hirsu2|10929
ATGGCCTCGGACCCCAGCCACGGCGACGAGGGCTCCAGTCGTTTCCATTCCGCCTCCTCTGCCGAAGCCGGCCGT
CGCCCGCGCGGCTCCGATTCCTATGTCAACATCAACGCCAACGTCGAAGCCAGGATCAAGAACCCCCTGATCGGC
CTCCCGCGCCGGACCCTGCTCAGCAACGTCGATGACTTCTGCCGCCTCAAGGGCCTCGACGCCCACCGCGACATC
CTCCGCAAGGGGGCCCTCGTCGCCCAGGACCCGACCGGCTACGAGGACATCACCGGCGACGAGGCCCTGACCGAG
GACGAGGTCGAGGCCCTCCGCAACGAGGTCCTCAACAAGTGGCGCATCCCCAGGCTCCTCTACCTCACCATCATT
ACCTGCTCCATCGGCGCCGCCGTCCAGGGATGGGACCAGACCGGCTCCAACGGCGCCAACCTGCAGTTCCCCCAG
GCCCTGCACATCGGCAGCAAGACGATCCGCGACAAGATACTCGTCGGCCTCGTCAACGCCGCCCCCTACATCGGC
ACCGCCCTCTTCGGCTGCTGGCTGTCCGACCCCATCAACAACTACTTCGGCCGCCGCGGCACCATCTTCATCGCC
GCCAACTTTTGTCTCTGGCCCGTCCTGGCCTGCGCCTTTTGCAACACCTGGGTCCAGCTTCTCGGCTGCCGCCTG
CTGCTCGGCGTCGGCATGGGCACCAAGGCATCCACCGTGCCCATCTTCGCCGCCGAAAACTCGCCGGCGCCCATC
CGTGGGGCCCTGGTCATGAGCTGGCAGCTGTGGAACGCCTTCGGCATCTTCCTCGGCACCTGCGCCAACCTGATC
TGCATGAGGATAGGCCCCAACTCCTGGAGGTACCAGCTCGGCTCGGCCTTCATCCCCGCCGTGCCGCTCGTCATC
CTCGTCTACTTCTGCCCCGAGTCCCCGCGCTGGTACATCAAGAAGAACCGGTACGCCGACGCCTTCCGCTCGCTG
CTCCGCCTGCGCAACAACCCGATCCAGGCCGCCCGCGACCTCTACTACATCCACGTCCAGCTCCAGGTCGAGAGC
GAGTTCATCGTCCACGGCACCTACATCGGCCGCTTCTTCGACCTCTTCACCATCCCCCGCGTCCGCCGCGCCACC
CTCGCCTCCTTCGTCGTCATGATCGCGCAGCAGATGTGCGGCATCAACATCATCGCCTTTTACTCCTCCTCCGTC
TTCGCCGTCGGCGGCGCCACCGACTTCGACGCCCTCATGGCCACCTGGGGCTTCGGCCTCATCAACTTCCTCTTC
GCCATCCCGGCCATCTGGACCATCGACACCTTCGGCCGACGCACCCTGCTGCTCTTCACCTTCCCGCAGATGGCC
TGGACCCTGCTCGCGGCCGGGCTCTGCAGCGCCCTGATCCCGGACCCGGAGAAGAGCAAGGTGCACATGGCCTTC
GTCGCCCTCTTCGTCTACCTGTTCGCCGCCTTCTACTCGCCCGGCGAAGGCCCCGTGCCCTTCACCTACAGCGCC
GAGGTGTTCCCCCTGTCGCATCGCGAGGTCGGCATGGCCTGGGCCGTGGCCACGTGCCTCTTCTGGGCCGCCGTG
CTCTCCGTCACCTTCCCCCTCATGCTCGACCGGCTGGCGGCCTTTGGGTCCTTTGGCCTGTACGCCGTCTTCAAC
ATCGTCGCCCTCGTCATGATCTTCCTGTGGGTGCCGGAGACGAAGCAGCGGACGCTGGAGGAGCTCGACTACATC
TTTGGCGTGCCGACCCGCGTCTTCATGAAGTACCAGGTCACCAAGGCCTTGCCCTGGTGGTTCAAGCGCTGGATC
CTGTTCCGGAGGGACGCGACCCTCGAGCCGCTCTACCGACTCGACGTGGCGGAGAACGAAGAAGACGAGCAACAG
AGCACGGATATCGGCTTCGAGAACGACAAGGCCAGGGTGGAGCTCAAAGACATTGCGGGATTTCCCACCGTCAGG
CGGACGGACGAGCCGTCGTCGGGCCCTACGGCTCCTCCTCGCTGA
Transcript >Hirsu2|10929
ATGGCCTCGGACCCCAGCCACGGCGACGAGGGCTCCAGTCGTTTCCATTCCGCCTCCTCTGCCGAAGCCGGCCGT
CGCCCGCGCGGCTCCGATTCCTATGTCAACATCAACGCCAACGTCGAAGCCAGGATCAAGAACCCCCTGATCGGC
CTCCCGCGCCGGACCCTGCTCAGCAACGTCGATGACTTCTGCCGCCTCAAGGGCCTCGACGCCCACCGCGACATC
CTCCGCAAGGGGGCCCTCGTCGCCCAGGACCCGACCGGCTACGAGGACATCACCGGCGACGAGGCCCTGACCGAG
GACGAGGTCGAGGCCCTCCGCAACGAGGTCCTCAACAAGTGGCGCATCCCCAGGCTCCTCTACCTCACCATCATT
ACCTGCTCCATCGGCGCCGCCGTCCAGGGATGGGACCAGACCGGCTCCAACGGCGCCAACCTGCAGTTCCCCCAG
GCCCTGCACATCGGCAGCAAGACGATCCGCGACAAGATACTCGTCGGCCTCGTCAACGCCGCCCCCTACATCGGC
ACCGCCCTCTTCGGCTGCTGGCTGTCCGACCCCATCAACAACTACTTCGGCCGCCGCGGCACCATCTTCATCGCC
GCCAACTTTTGTCTCTGGCCCGTCCTGGCCTGCGCCTTTTGCAACACCTGGGTCCAGCTTCTCGGCTGCCGCCTG
CTGCTCGGCGTCGGCATGGGCACCAAGGCATCCACCGTGCCCATCTTCGCCGCCGAAAACTCGCCGGCGCCCATC
CGTGGGGCCCTGGTCATGAGCTGGCAGCTGTGGAACGCCTTCGGCATCTTCCTCGGCACCTGCGCCAACCTGATC
TGCATGAGGATAGGCCCCAACTCCTGGAGGTACCAGCTCGGCTCGGCCTTCATCCCCGCCGTGCCGCTCGTCATC
CTCGTCTACTTCTGCCCCGAGTCCCCGCGCTGGTACATCAAGAAGAACCGGTACGCCGACGCCTTCCGCTCGCTG
CTCCGCCTGCGCAACAACCCGATCCAGGCCGCCCGCGACCTCTACTACATCCACGTCCAGCTCCAGGTCGAGAGC
GAGTTCATCGTCCACGGCACCTACATCGGCCGCTTCTTCGACCTCTTCACCATCCCCCGCGTCCGCCGCGCCACC
CTCGCCTCCTTCGTCGTCATGATCGCGCAGCAGATGTGCGGCATCAACATCATCGCCTTTTACTCCTCCTCCGTC
TTCGCCGTCGGCGGCGCCACCGACTTCGACGCCCTCATGGCCACCTGGGGCTTCGGCCTCATCAACTTCCTCTTC
GCCATCCCGGCCATCTGGACCATCGACACCTTCGGCCGACGCACCCTGCTGCTCTTCACCTTCCCGCAGATGGCC
TGGACCCTGCTCGCGGCCGGGCTCTGCAGCGCCCTGATCCCGGACCCGGAGAAGAGCAAGGTGCACATGGCCTTC
GTCGCCCTCTTCGTCTACCTGTTCGCCGCCTTCTACTCGCCCGGCGAAGGCCCCGTGCCCTTCACCTACAGCGCC
GAGGTGTTCCCCCTGTCGCATCGCGAGGTCGGCATGGCCTGGGCCGTGGCCACGTGCCTCTTCTGGGCCGCCGTG
CTCTCCGTCACCTTCCCCCTCATGCTCGACCGGCTGGCGGCCTTTGGGTCCTTTGGCCTGTACGCCGTCTTCAAC
ATCGTCGCCCTCGTCATGATCTTCCTGTGGGTGCCGGAGACGAAGCAGCGGACGCTGGAGGAGCTCGACTACATC
TTTGGCGTGCCGACCCGCGTCTTCATGAAGTACCAGGTCACCAAGGCCTTGCCCTGGTGGTTCAAGCGCTGGATC
CTGTTCCGGAGGGACGCGACCCTCGAGCCGCTCTACCGACTCGACGTGGCGGAGAACGAAGAAGACGAGCAACAG
AGCACGGATATCGGCTTCGAGAACGACAAGGCCAGGGTGGAGCTCAAAGACATTGCGGGATTTCCCACCGTCAGG
CGGACGGACGAGCCGTCGTCGGGCCCTACGGCTCCTCCTCGCTGA
Gene >Hirsu2|10929
ATGGCCTCGGACCCCAGCCACGGCGACGAGGGCTCCAGGTAATGTCTCATCCCGCCCGTCTGCGCGCCCTTGGCG
TCGCCTCTCTTGCTCCTGCGCTCGCCGTAGATGCATCGTCGTCGCGCGCATCAACTGACTCGGTGCGCGCCAGGA
CTCGTAGTCGTTTCCATTCCGCCTCCTCTGCCGAAGCCGGCCGTCGCCCGCGCGGCTCCGATTCCTATGTCAACA
TCAACGCCAACGTCGAAGCCAGGTGCGGCCGCCTCTCCTTCTCCCCTCGTCCCATGCCGCCGCGCTCTCTGTTCC
TGACGCCTCCTCTGCCTCTCTTCCTTCCCCCCCTCTTCCAGGATCAAGAACCCCCTGATCGGCCTCCCGCGCCGG
ACCCTGCTCAGCAACGTCGATGACTTCTGCCGCCTCAAGGGCCTCGACGCCCACCGCGACATCCTCCGCAAGGGG
GCCCTCGTCGCCCAGGACCCGACCGGCTACGAGGACATCACCGGCGACGAGGCCCTGACCGAGGACGAGGTCGAG
GCCCTCCGCAACGAGGTCCTCAACAAGTGGCGCATCCCCAGGCTCCTCTACCTCACCATCATTACCTGCTCCATC
GGCGCCGCCGTCCAGGGATGGGACCAGACCGGCTCCAACGGCGCCAACCTGCAGTTCCCCCAGGCCCTGCACATC
GGCAGCAAGACGATCCGCGACAAGATACTCGTCGGCCTCGTCAACGCCGCCCCCTACATCGGCACCGCCCTCTTC
GGCTGCTGGCTGTCCGACCCCATCAACAACTACTTCGGCCGCCGCGGCACCATCTTCATCGCCGCCAACTTTTGT
CTCTGGCCCGTCCTGGCCTGCGCCTTTTGCAACACCTGGGTCCAGCTTCTCGGCTGCCGCCTGCTGCTCGGCGTC
GGCATGGGCACCAAGGCATCCACCGGTGAGTCTCTGCCCGGCCTGCTCGTCATCCCCTCTGCCCCTTGCCGTGCT
GACCACGGCGCAGTGCCCATCTTCGCCGCCGAAAACTCGCCGGCGCCCATCCGTGGGGCCCTGGTCATGAGCTGG
CAGCTGTGGAACGCCTTCGGCATCTTCCTCGGCACCTGCGCCAACCTGATCTGCATGAGGATAGGCCCCAACTCC
TGGAGGTACCAGCTCGGCTCGGCCTTCATCCCCGCCGTGCCGCTCGTCATCCTCGTCTACTTCTGCCCCGAGTCC
CCGCGCTGGTACATCAAGAAGAACCGGTACGCCGACGCCTTCCGCTCGCTGCTCCGCCTGCGCAACAACCCGATC
CAGGCCGCCCGCGACCTCTACTACATCCACGTCCAGCTCCAGGTCGAGAGCGAGTTCATCGTCCACGGCACCTAC
ATCGGCCGCTTCTTCGACCTCTTCACCATCCCCCGCGTCCGCCGCGCCACCCTCGCCTCCTTCGTCGTCATGATC
GCGCAGCAGATGTGCGGCATCAACATCATCGCCTTTTACTCCTCCTCCGTCTTCGCCGTCGGCGGCGCCACCGAC
TTCGACGCCCTCATGGCCACCTGGGGCTTCGGCCTCATCAACTTCCTCTTCGCCATCCCGGCCATCTGGACCATC
GACACCTTCGGCCGACGCACCCTGCTGCTCTTCACCTTCCCGCAGATGGCCTGGACCCTGCTCGCGGCCGGGCTC
TGCAGCGCCCTGATCCCGGACCCGGAGAAGAGCAAGGTGCACATGGCCTTCGTCGCCCTCTTCGTCTACCTGTTC
GCCGCCTTCTACTCGCCCGGCGAAGGCCCCGTGCCCTTCACCTACAGCGCCGAGGTGTTCCCCCTGTCGCATCGC
GAGGTCGGCATGGCCTGGGCCGTGGCCACGTGCCTCTTCTGGGCCGCCGTGCTCTCCGTCACCTTCCCCCTCATG
CTCGACCGGCTGGCGGCCTTTGGGTCCTTTGGCCTGTACGCCGTCTTCAACATCGTCGCCCTCGTCATGATCTTC
CTGTGGGTGCCGGAGACGAAGCAGCGGACGCTGGAGGAGCTCGACTACATCTTTGGCGTGCCGACCCGCGTCTTC
ATGAAGTACCAGGTCACCAAGGCCTTGCCCTGGTGGTTCAAGCGCTGGATCCTGTTCCGGAGGGACGCGACCCTC
GAGCCGCTCTACCGACTCGACGTGGCGGAGAACGAAGAAGACGAGCAACAGAGCACGGATATCGGCTTCGAGAAC
GACAAGGCCAGGGTGGAGCTCAAAGACATTGCGGGATTTCCCACCGTCAGGCGGACGGACGAGCCGTCGTCGGGC
CCTACGGCTCCTCCTCGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail