Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10924
Gene name
LocationContig_928:16..883
Strand+
Gene length (bp)867
Transcript length (bp)867
Coding sequence length (bp)867
Protein length (aa) 289

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 3.3E-11 17 173

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P29027|CHI2_RHIOL Chitinase 2 OS=Rhizopus oligosporus GN=CHI2 PE=1 SV=1 18 221 9.0E-09
sp|P29026|CHI1_RHIOL Chitinase 1 OS=Rhizopus oligosporus GN=CHI1 PE=1 SV=1 18 239 1.0E-08

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10924
LTLNDHPPDHPRFDTLWAELRVLQAAGVRVLAMLGGAAAGSYRRLDGAEAEFEAYYAPLHRLVRARGLDGLDLDV
EEPTSLAGVVRLVDRLRADFGPGFLITLAPVAAALLDADRNLSGFDYEALEVLRGRDIAWYNAQFYCGWGDLSST
RMYDLMLLKGWPAHKLVVGLVTNPANGKGFVPWHQLSVLLDLISRRQPNFGGVMGWEYFNSLPGDADRPWEWAHH
MASLLRGRPSEPRPPQGPETSSVSASSRAHVPPGQEVDSDGPDAACLELPAPFDYYSEGEKDG*
Coding >Hirsu2|10924
CTGACGCTCAACGACCACCCGCCCGACCACCCGCGCTTCGACACGCTCTGGGCCGAGCTGCGCGTGCTGCAGGCG
GCGGGCGTCCGGGTGCTGGCCATGCTGGGCGGCGCCGCCGCCGGCTCCTACCGCCGGCTCGACGGCGCCGAGGCC
GAGTTCGAGGCCTACTACGCCCCGCTGCACCGCCTCGTCCGCGCCCGCGGCCTCGACGGCCTCGACCTTGACGTC
GAGGAGCCCACCAGCCTCGCCGGCGTCGTCCGCCTCGTCGACCGGCTCCGCGCCGACTTCGGCCCCGGCTTCCTC
ATCACCTTGGCCCCCGTCGCCGCCGCCCTGCTCGACGCCGACCGAAACCTGAGCGGCTTCGACTACGAGGCGCTC
GAGGTCCTGCGCGGCCGCGACATCGCCTGGTACAACGCCCAGTTCTACTGCGGCTGGGGCGACCTGTCCAGCACC
CGCATGTACGATCTCATGCTGCTCAAGGGCTGGCCCGCCCACAAGCTCGTCGTCGGCCTCGTCACCAACCCCGCC
AACGGCAAGGGCTTCGTCCCCTGGCACCAGCTGTCCGTCCTCCTCGACCTCATCAGCCGCCGCCAGCCCAACTTT
GGCGGCGTCATGGGCTGGGAGTACTTCAACAGCCTCCCCGGCGACGCCGACCGCCCCTGGGAGTGGGCTCATCAT
ATGGCTTCTCTGCTCAGGGGCCGTCCTTCGGAGCCGCGCCCGCCCCAAGGGCCCGAAACGTCCTCTGTCTCGGCC
TCGTCCCGCGCTCACGTACCGCCAGGACAAGAAGTCGATTCAGACGGTCCCGATGCTGCTTGCCTGGAACTTCCT
GCGCCATTTGACTATTATTCCGAAGGAGAGAAAGACGGCTGA
Transcript >Hirsu2|10924
CTGACGCTCAACGACCACCCGCCCGACCACCCGCGCTTCGACACGCTCTGGGCCGAGCTGCGCGTGCTGCAGGCG
GCGGGCGTCCGGGTGCTGGCCATGCTGGGCGGCGCCGCCGCCGGCTCCTACCGCCGGCTCGACGGCGCCGAGGCC
GAGTTCGAGGCCTACTACGCCCCGCTGCACCGCCTCGTCCGCGCCCGCGGCCTCGACGGCCTCGACCTTGACGTC
GAGGAGCCCACCAGCCTCGCCGGCGTCGTCCGCCTCGTCGACCGGCTCCGCGCCGACTTCGGCCCCGGCTTCCTC
ATCACCTTGGCCCCCGTCGCCGCCGCCCTGCTCGACGCCGACCGAAACCTGAGCGGCTTCGACTACGAGGCGCTC
GAGGTCCTGCGCGGCCGCGACATCGCCTGGTACAACGCCCAGTTCTACTGCGGCTGGGGCGACCTGTCCAGCACC
CGCATGTACGATCTCATGCTGCTCAAGGGCTGGCCCGCCCACAAGCTCGTCGTCGGCCTCGTCACCAACCCCGCC
AACGGCAAGGGCTTCGTCCCCTGGCACCAGCTGTCCGTCCTCCTCGACCTCATCAGCCGCCGCCAGCCCAACTTT
GGCGGCGTCATGGGCTGGGAGTACTTCAACAGCCTCCCCGGCGACGCCGACCGCCCCTGGGAGTGGGCTCATCAT
ATGGCTTCTCTGCTCAGGGGCCGTCCTTCGGAGCCGCGCCCGCCCCAAGGGCCCGAAACGTCCTCTGTCTCGGCC
TCGTCCCGCGCTCACGTACCGCCAGGACAAGAAGTCGATTCAGACGGTCCCGATGCTGCTTGCCTGGAACTTCCT
GCGCCATTTGACTATTATTCCGAAGGAGAGAAAGACGGCTGA
Gene >Hirsu2|10924
CTGACGCTCAACGACCACCCGCCCGACCACCCGCGCTTCGACACGCTCTGGGCCGAGCTGCGCGTGCTGCAGGCG
GCGGGCGTCCGGGTGCTGGCCATGCTGGGCGGCGCCGCCGCCGGCTCCTACCGCCGGCTCGACGGCGCCGAGGCC
GAGTTCGAGGCCTACTACGCCCCGCTGCACCGCCTCGTCCGCGCCCGCGGCCTCGACGGCCTCGACCTTGACGTC
GAGGAGCCCACCAGCCTCGCCGGCGTCGTCCGCCTCGTCGACCGGCTCCGCGCCGACTTCGGCCCCGGCTTCCTC
ATCACCTTGGCCCCCGTCGCCGCCGCCCTGCTCGACGCCGACCGAAACCTGAGCGGCTTCGACTACGAGGCGCTC
GAGGTCCTGCGCGGCCGCGACATCGCCTGGTACAACGCCCAGTTCTACTGCGGCTGGGGCGACCTGTCCAGCACC
CGCATGTACGATCTCATGCTGCTCAAGGGCTGGCCCGCCCACAAGCTCGTCGTCGGCCTCGTCACCAACCCCGCC
AACGGCAAGGGCTTCGTCCCCTGGCACCAGCTGTCCGTCCTCCTCGACCTCATCAGCCGCCGCCAGCCCAACTTT
GGCGGCGTCATGGGCTGGGAGTACTTCAACAGCCTCCCCGGCGACGCCGACCGCCCCTGGGAGTGGGCTCATCAT
ATGGCTTCTCTGCTCAGGGGCCGTCCTTCGGAGCCGCGCCCGCCCCAAGGGCCCGAAACGTCCTCTGTCTCGGCC
TCGTCCCGCGCTCACGTACCGCCAGGACAAGAAGTCGATTCAGACGGTCCCGATGCTGCTTGCCTGGAACTTCCT
GCGCCATTTGACTATTATTCCGAAGGAGAGAAAGACGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail