Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10905
Gene name
LocationContig_924:3815..7739
Strand-
Gene length (bp)3924
Transcript length (bp)3840
Coding sequence length (bp)3840
Protein length (aa) 1280

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 1.3E-75 720 1001
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 1.9E-43 56 220
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 4.0E-10 245 318
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 2.9E-16 603 709
PF12621 PHM7_ext Extracellular tail, of 10TM putative phosphate transporter 9.4E-14 1199 1270

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 604 1274 2.0E-78
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 602 1273 3.0E-65
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 606 1106 5.0E-56
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 665 1123 6.0E-30
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 628 1133 7.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 604 1274 2.0E-78
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 602 1273 3.0E-65
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 606 1106 5.0E-56
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 665 1123 6.0E-30
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 628 1133 7.0E-30
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 628 1057 4.0E-24
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 633 1071 2.0E-23
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 54 304 5.0E-23
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 555 1000 4.0E-22
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 603 1071 5.0E-22
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 630 1000 5.0E-22
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 668 1058 2.0E-21
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 650 1093 9.0E-21
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 584 1105 2.0E-20
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 667 1091 5.0E-20
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 628 999 3.0E-19
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 630 999 8.0E-19
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 65 316 5.0E-18
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 702 1066 8.0E-17
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 567 999 3.0E-16
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 702 1001 1.0E-15
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 702 1001 2.0E-14
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 667 1046 1.0E-13
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 114 253 3.0E-10
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 84 253 4.0E-10
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 46 324 1.0E-09
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 114 253 1.0E-09
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 114 253 1.0E-08
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 120 253 1.0E-08
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 114 253 3.0E-08
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 114 300 6.0E-08
sp|Q5T3F8|CSCL2_HUMAN CSC1-like protein 2 OS=Homo sapiens GN=TMEM63B PE=1 SV=1 702 1034 2.0E-07
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 611 1010 3.0E-07
sp|Q3TWI9|CSCL2_MOUSE CSC1-like protein 2 OS=Mus musculus GN=Tmem63b PE=1 SV=1 702 1034 3.0E-07
sp|Q5R826|CSCL1_PONAB CSC1-like protein 1 OS=Pongo abelii GN=TMEM63A PE=2 SV=1 636 1059 1.0E-06
sp|O94886|CSCL1_HUMAN CSC1-like protein 1 OS=Homo sapiens GN=TMEM63A PE=1 SV=3 636 1004 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 52 74 22
2 139 161 22
3 200 222 22
4 723 745 22
5 778 800 22
6 813 835 22
7 877 899 22
8 934 956 22
9 982 1004 22
10 1017 1034 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10905
MAANALASAPPWTPDASFADPLHRPVSTFAPFVLAARETATTPGKAQASQNIGIVSFLTAIGVALAIFSSQFLLF
TLLRNKLARIFKPRTYLVPERERTASPPSNIVSLIRRIVKYDDREVINKCGLDAYFFLRYLKTLLVIFIPICAVV
LPVLIPINYIGGKGHQVNINDAQRKSDNSTPSGLDTLAWGNVSSKNTSRYGAHLVMAILVVIWVCSVFFFELRVY
IKVRQDYLTSAEHRLRASATTVLVNSIPKKWLSEEALLGLFDVFPGGVRNIWLNRDLTKLLDKIHERRRVHEMLE
SAETDLIKAAKKAQIKQRDAEERQQRRKQSLRPLSKEEKAARQAEEDAEASRLANSDEVAHASHDDLPHTLDGGL
LESELEMLERDSCELETVIEEGGKASGGFVARGVKNPLSKVGKGLKGAATKAGNEVDSTLGRSHGFSGSGAASKE
TVTFGPSSTVKVYGVDEKDGPPRLSEQPLEAARTHSRAPSAVSENSTVGTQRTSHGAMPGNTVRKLVNEDDMYVH
GRTRFWEFWKPPSGAYTSPVPQGEAARDYMVGKATNDKSVWQRFKTRLPFMGEAEEAYVYPAAHSPGRKADEDDG
AEWARYLKKKDRPTHRLPPFAIHWLPGLPLVNKKVDTIYWCREQLARLNVEIEEDQKHPERFPLMCSAFVQFNHQ
VAAHMACQSVVHHIPRQMSPRMNEISPRDVIWDNMAISWWQEWLRTAIVAIVVGAMIFLWAIPVAWTAALSQLDS
IIHDAGWLGSLQDNQVAENVVKAVSGVLPAAVLALLLILVPLILGLMAEFKGAKTGAQKTEFIQIFYFVFLFIQV
FLIVSIASFFAKSIGDFVKRITELQSVSAVLDLLAENLPASANYFFSYMILQALSTSSGTLLQIGALFMWFVLAP
MFDSTARSKWRRNTTLNQIEWGSFFPVYTNFACIGLIYCVIAPLISVFAVITFSLLWLAQRYAMLYVNRFETDTG
GVLYPRAINQTFTGIYFMELCMAGLFFIAQDNKGRHTCTTHGIVMIVVSILTLTYQVLLNKSFSPLFRNLPITFE
DEAVLRDEAFQRAQDVRFGLRRDEPRLDLGPADRGGEEGRPSVGEGAGRLMDDDDHRREQDRGEVRREPSMRHLR
EHVKQVGHWAKDGGKQVGTWAKDGGHQLRKLKNMGDNTKAVQYRRRQRQRDLEAQRAIGDALYGGVHDDIEDLTP
EERGLLTRHAFQHCALRVRRPTVWIPRDDLGVSDDEMARTRAYSEHIWISNEGTALDSKVRVVYGKNPPDFSEVD
IINL*
Coding >Hirsu2|10905
ATGGCGGCAAACGCCCTCGCCTCGGCACCCCCTTGGACGCCCGATGCCTCCTTTGCTGACCCTCTGCACCGCCCC
GTCTCGACCTTCGCCCCCTTCGTCCTGGCAGCGAGAGAAACGGCCACGACGCCGGGCAAGGCCCAGGCTTCCCAG
AACATCGGCATCGTCAGCTTCCTCACCGCCATCGGCGTCGCCCTGGCCATCTTTTCCTCTCAATTCCTGCTCTTC
ACGCTCCTGCGTAACAAGCTGGCCCGCATCTTTAAACCGAGAACATATCTTGTCCCCGAGCGGGAGAGGACCGCA
TCGCCGCCCTCGAACATCGTGTCCCTAATCAGACGCATAGTCAAGTATGACGATCGCGAGGTCATCAACAAGTGT
GGCCTCGACGCATATTTCTTCCTTCGCTACCTCAAGACGCTCCTCGTCATCTTCATCCCCATCTGCGCCGTCGTC
TTGCCCGTTCTGATCCCGATCAACTACATTGGCGGCAAGGGGCACCAGGTCAACATCAACGACGCCCAGAGAAAG
TCGGACAACTCCACCCCGTCCGGCCTCGACACGCTGGCCTGGGGCAATGTCAGCTCAAAGAACACCAGCCGCTAC
GGCGCCCACCTGGTCATGGCCATCCTCGTCGTCATCTGGGTCTGTTCCGTCTTCTTCTTCGAGCTGCGCGTCTAC
ATCAAGGTCCGCCAGGACTACCTCACCAGCGCCGAACACCGATTGCGGGCCTCGGCCACCACCGTCCTCGTCAAT
TCCATCCCCAAGAAGTGGCTCAGCGAGGAGGCCCTCCTCGGCCTGTTCGACGTCTTCCCGGGCGGTGTTCGGAAC
ATTTGGCTGAACAGAGACCTGACCAAGCTGCTCGACAAGATCCACGAGAGACGCAGGGTTCACGAGATGCTCGAG
TCGGCCGAGACGGACCTCATCAAGGCCGCCAAGAAGGCCCAGATCAAACAGAGGGACGCCGAAGAGAGGCAGCAG
AGGAGGAAGCAGAGCCTCAGGCCTCTCTCCAAGGAAGAGAAGGCCGCCCGCCAAGCGGAGGAAGACGCGGAAGCC
AGCCGGCTGGCCAATAGCGATGAGGTGGCCCACGCCAGCCATGACGATCTCCCCCATACCCTGGACGGCGGCCTC
CTCGAGTCGGAGCTGGAAATGCTCGAAAGGGATAGTTGCGAGCTGGAGACTGTCATCGAGGAAGGCGGCAAGGCT
TCTGGTGGCTTCGTCGCCCGCGGAGTCAAGAACCCGTTGTCCAAGGTGGGAAAGGGCCTCAAGGGTGCTGCTACA
AAGGCCGGCAACGAGGTCGACAGCACGCTCGGCCGAAGCCACGGCTTTTCCGGCAGTGGTGCGGCCAGTAAGGAG
ACGGTCACGTTCGGCCCGTCCAGTACCGTCAAGGTCTACGGCGTCGACGAGAAAGACGGTCCGCCGCGATTGTCG
GAGCAACCGCTGGAGGCGGCTCGAACGCACTCGCGTGCCCCGTCCGCCGTCTCGGAAAACTCGACCGTGGGCACG
CAGAGAACCAGCCACGGCGCCATGCCCGGAAACACGGTCCGCAAACTCGTCAACGAGGACGACATGTACGTGCAC
GGGCGGACGAGGTTCTGGGAGTTTTGGAAGCCCCCGTCGGGCGCGTATACGTCTCCCGTGCCTCAGGGAGAGGCG
GCCAGGGATTACATGGTCGGTAAGGCGACCAACGACAAGTCCGTCTGGCAGCGCTTCAAGACACGTCTCCCTTTC
ATGGGCGAGGCCGAGGAGGCGTACGTGTACCCCGCGGCCCACTCCCCGGGCCGCAAGGCCGACGAGGACGACGGA
GCCGAGTGGGCAAGATATCTCAAGAAAAAGGACCGGCCGACGCATCGGCTGCCCCCCTTTGCCATCCACTGGCTG
CCCGGCCTCCCTCTCGTCAACAAGAAGGTGGACACTATTTACTGGTGCCGGGAGCAGCTCGCGCGGCTCAACGTG
GAGATCGAGGAGGACCAGAAGCACCCGGAACGGTTCCCGCTCATGTGCTCGGCCTTCGTCCAGTTCAACCACCAG
GTCGCGGCGCACATGGCCTGCCAGAGCGTCGTCCACCACATCCCGCGGCAGATGTCGCCGCGCATGAACGAGATA
TCCCCCCGCGACGTCATCTGGGACAACATGGCCATCAGCTGGTGGCAGGAGTGGCTGCGGACCGCCATCGTCGCC
ATCGTCGTGGGGGCCATGATCTTCCTGTGGGCCATACCCGTCGCCTGGACGGCCGCCCTGAGCCAGCTGGACTCC
ATCATCCACGACGCCGGCTGGCTCGGGTCCCTGCAGGACAACCAGGTGGCGGAGAACGTGGTCAAGGCCGTGTCC
GGTGTGCTGCCCGCGGCCGTGCTCGCGCTCCTGCTGATCCTGGTGCCCCTCATCCTCGGCCTGATGGCCGAGTTC
AAGGGCGCCAAGACGGGCGCCCAGAAGACGGAGTTTATCCAGATCTTTTACTTCGTCTTTCTTTTCATCCAAGTC
TTCCTCATCGTCTCCATCGCGTCCTTCTTCGCCAAGTCGATCGGCGACTTTGTTAAGCGCATCACGGAGCTGCAG
TCGGTCAGCGCCGTCCTGGACCTGCTGGCCGAGAACCTGCCGGCGTCGGCCAACTACTTCTTCTCCTACATGATC
CTGCAGGCGCTGTCGACGAGCTCGGGCACGCTGCTCCAGATCGGCGCGCTGTTCATGTGGTTCGTGCTGGCGCCC
ATGTTCGACAGCACGGCGCGGAGCAAGTGGCGGCGGAACACGACGCTCAACCAGATCGAATGGGGCTCCTTCTTC
CCGGTCTACACCAACTTCGCGTGCATCGGGCTGATCTACTGCGTCATCGCGCCCCTCATCTCCGTCTTCGCCGTC
ATCACCTTCAGCCTGCTGTGGCTGGCCCAGAGATACGCGATGCTGTACGTCAACAGGTTCGAGACGGACACCGGC
GGCGTCCTCTACCCGCGGGCCATCAACCAGACCTTCACGGGCATCTACTTCATGGAGCTCTGCATGGCCGGCCTG
TTCTTCATCGCGCAAGACAACAAGGGCAGGCACACGTGCACGACGCACGGCATCGTCATGATCGTGGTCTCGATC
CTGACGCTCACCTACCAGGTCCTCCTCAACAAGTCCTTCTCCCCGCTCTTCCGCAACCTGCCGATCACGTTCGAG
GACGAGGCGGTGCTCCGAGACGAAGCCTTCCAGCGGGCGCAGGACGTGCGGTTCGGCCTGCGGCGCGACGAGCCA
CGGCTCGACCTGGGCCCGGCCGACAGGGGCGGCGAGGAGGGGCGGCCGAGCGTCGGGGAGGGCGCGGGCCGGCTC
ATGGACGACGACGACCACCGCCGCGAGCAGGACCGCGGCGAGGTGCGGCGGGAACCGTCGATGCGCCACCTGCGG
GAACACGTCAAGCAGGTCGGCCACTGGGCCAAGGACGGCGGCAAGCAGGTCGGGACGTGGGCCAAGGACGGCGGG
CACCAGCTGCGCAAGCTGAAGAACATGGGCGACAACACCAAGGCGGTGCAGTACCGGCGGCGGCAGCGGCAGCGC
GACCTGGAGGCGCAGCGGGCCATCGGCGACGCGCTCTACGGCGGGGTGCACGACGACATCGAGGACCTGACGCCC
GAGGAGCGCGGCCTGCTGACGCGGCACGCCTTCCAGCACTGCGCGCTGCGCGTGCGCCGGCCGACGGTCTGGATC
CCGCGCGACGACCTGGGCGTCAGCGACGACGAGATGGCCCGGACGCGCGCCTACAGCGAGCACATCTGGATCAGC
AACGAGGGTACGGCGCTCGACAGCAAGGTGCGCGTCGTCTACGGCAAGAACCCGCCCGACTTTTCCGAGGTGGAC
ATCATCAACCTCTAG
Transcript >Hirsu2|10905
ATGGCGGCAAACGCCCTCGCCTCGGCACCCCCTTGGACGCCCGATGCCTCCTTTGCTGACCCTCTGCACCGCCCC
GTCTCGACCTTCGCCCCCTTCGTCCTGGCAGCGAGAGAAACGGCCACGACGCCGGGCAAGGCCCAGGCTTCCCAG
AACATCGGCATCGTCAGCTTCCTCACCGCCATCGGCGTCGCCCTGGCCATCTTTTCCTCTCAATTCCTGCTCTTC
ACGCTCCTGCGTAACAAGCTGGCCCGCATCTTTAAACCGAGAACATATCTTGTCCCCGAGCGGGAGAGGACCGCA
TCGCCGCCCTCGAACATCGTGTCCCTAATCAGACGCATAGTCAAGTATGACGATCGCGAGGTCATCAACAAGTGT
GGCCTCGACGCATATTTCTTCCTTCGCTACCTCAAGACGCTCCTCGTCATCTTCATCCCCATCTGCGCCGTCGTC
TTGCCCGTTCTGATCCCGATCAACTACATTGGCGGCAAGGGGCACCAGGTCAACATCAACGACGCCCAGAGAAAG
TCGGACAACTCCACCCCGTCCGGCCTCGACACGCTGGCCTGGGGCAATGTCAGCTCAAAGAACACCAGCCGCTAC
GGCGCCCACCTGGTCATGGCCATCCTCGTCGTCATCTGGGTCTGTTCCGTCTTCTTCTTCGAGCTGCGCGTCTAC
ATCAAGGTCCGCCAGGACTACCTCACCAGCGCCGAACACCGATTGCGGGCCTCGGCCACCACCGTCCTCGTCAAT
TCCATCCCCAAGAAGTGGCTCAGCGAGGAGGCCCTCCTCGGCCTGTTCGACGTCTTCCCGGGCGGTGTTCGGAAC
ATTTGGCTGAACAGAGACCTGACCAAGCTGCTCGACAAGATCCACGAGAGACGCAGGGTTCACGAGATGCTCGAG
TCGGCCGAGACGGACCTCATCAAGGCCGCCAAGAAGGCCCAGATCAAACAGAGGGACGCCGAAGAGAGGCAGCAG
AGGAGGAAGCAGAGCCTCAGGCCTCTCTCCAAGGAAGAGAAGGCCGCCCGCCAAGCGGAGGAAGACGCGGAAGCC
AGCCGGCTGGCCAATAGCGATGAGGTGGCCCACGCCAGCCATGACGATCTCCCCCATACCCTGGACGGCGGCCTC
CTCGAGTCGGAGCTGGAAATGCTCGAAAGGGATAGTTGCGAGCTGGAGACTGTCATCGAGGAAGGCGGCAAGGCT
TCTGGTGGCTTCGTCGCCCGCGGAGTCAAGAACCCGTTGTCCAAGGTGGGAAAGGGCCTCAAGGGTGCTGCTACA
AAGGCCGGCAACGAGGTCGACAGCACGCTCGGCCGAAGCCACGGCTTTTCCGGCAGTGGTGCGGCCAGTAAGGAG
ACGGTCACGTTCGGCCCGTCCAGTACCGTCAAGGTCTACGGCGTCGACGAGAAAGACGGTCCGCCGCGATTGTCG
GAGCAACCGCTGGAGGCGGCTCGAACGCACTCGCGTGCCCCGTCCGCCGTCTCGGAAAACTCGACCGTGGGCACG
CAGAGAACCAGCCACGGCGCCATGCCCGGAAACACGGTCCGCAAACTCGTCAACGAGGACGACATGTACGTGCAC
GGGCGGACGAGGTTCTGGGAGTTTTGGAAGCCCCCGTCGGGCGCGTATACGTCTCCCGTGCCTCAGGGAGAGGCG
GCCAGGGATTACATGGTCGGTAAGGCGACCAACGACAAGTCCGTCTGGCAGCGCTTCAAGACACGTCTCCCTTTC
ATGGGCGAGGCCGAGGAGGCGTACGTGTACCCCGCGGCCCACTCCCCGGGCCGCAAGGCCGACGAGGACGACGGA
GCCGAGTGGGCAAGATATCTCAAGAAAAAGGACCGGCCGACGCATCGGCTGCCCCCCTTTGCCATCCACTGGCTG
CCCGGCCTCCCTCTCGTCAACAAGAAGGTGGACACTATTTACTGGTGCCGGGAGCAGCTCGCGCGGCTCAACGTG
GAGATCGAGGAGGACCAGAAGCACCCGGAACGGTTCCCGCTCATGTGCTCGGCCTTCGTCCAGTTCAACCACCAG
GTCGCGGCGCACATGGCCTGCCAGAGCGTCGTCCACCACATCCCGCGGCAGATGTCGCCGCGCATGAACGAGATA
TCCCCCCGCGACGTCATCTGGGACAACATGGCCATCAGCTGGTGGCAGGAGTGGCTGCGGACCGCCATCGTCGCC
ATCGTCGTGGGGGCCATGATCTTCCTGTGGGCCATACCCGTCGCCTGGACGGCCGCCCTGAGCCAGCTGGACTCC
ATCATCCACGACGCCGGCTGGCTCGGGTCCCTGCAGGACAACCAGGTGGCGGAGAACGTGGTCAAGGCCGTGTCC
GGTGTGCTGCCCGCGGCCGTGCTCGCGCTCCTGCTGATCCTGGTGCCCCTCATCCTCGGCCTGATGGCCGAGTTC
AAGGGCGCCAAGACGGGCGCCCAGAAGACGGAGTTTATCCAGATCTTTTACTTCGTCTTTCTTTTCATCCAAGTC
TTCCTCATCGTCTCCATCGCGTCCTTCTTCGCCAAGTCGATCGGCGACTTTGTTAAGCGCATCACGGAGCTGCAG
TCGGTCAGCGCCGTCCTGGACCTGCTGGCCGAGAACCTGCCGGCGTCGGCCAACTACTTCTTCTCCTACATGATC
CTGCAGGCGCTGTCGACGAGCTCGGGCACGCTGCTCCAGATCGGCGCGCTGTTCATGTGGTTCGTGCTGGCGCCC
ATGTTCGACAGCACGGCGCGGAGCAAGTGGCGGCGGAACACGACGCTCAACCAGATCGAATGGGGCTCCTTCTTC
CCGGTCTACACCAACTTCGCGTGCATCGGGCTGATCTACTGCGTCATCGCGCCCCTCATCTCCGTCTTCGCCGTC
ATCACCTTCAGCCTGCTGTGGCTGGCCCAGAGATACGCGATGCTGTACGTCAACAGGTTCGAGACGGACACCGGC
GGCGTCCTCTACCCGCGGGCCATCAACCAGACCTTCACGGGCATCTACTTCATGGAGCTCTGCATGGCCGGCCTG
TTCTTCATCGCGCAAGACAACAAGGGCAGGCACACGTGCACGACGCACGGCATCGTCATGATCGTGGTCTCGATC
CTGACGCTCACCTACCAGGTCCTCCTCAACAAGTCCTTCTCCCCGCTCTTCCGCAACCTGCCGATCACGTTCGAG
GACGAGGCGGTGCTCCGAGACGAAGCCTTCCAGCGGGCGCAGGACGTGCGGTTCGGCCTGCGGCGCGACGAGCCA
CGGCTCGACCTGGGCCCGGCCGACAGGGGCGGCGAGGAGGGGCGGCCGAGCGTCGGGGAGGGCGCGGGCCGGCTC
ATGGACGACGACGACCACCGCCGCGAGCAGGACCGCGGCGAGGTGCGGCGGGAACCGTCGATGCGCCACCTGCGG
GAACACGTCAAGCAGGTCGGCCACTGGGCCAAGGACGGCGGCAAGCAGGTCGGGACGTGGGCCAAGGACGGCGGG
CACCAGCTGCGCAAGCTGAAGAACATGGGCGACAACACCAAGGCGGTGCAGTACCGGCGGCGGCAGCGGCAGCGC
GACCTGGAGGCGCAGCGGGCCATCGGCGACGCGCTCTACGGCGGGGTGCACGACGACATCGAGGACCTGACGCCC
GAGGAGCGCGGCCTGCTGACGCGGCACGCCTTCCAGCACTGCGCGCTGCGCGTGCGCCGGCCGACGGTCTGGATC
CCGCGCGACGACCTGGGCGTCAGCGACGACGAGATGGCCCGGACGCGCGCCTACAGCGAGCACATCTGGATCAGC
AACGAGGGTACGGCGCTCGACAGCAAGGTGCGCGTCGTCTACGGCAAGAACCCGCCCGACTTTTCCGAGGTGGAC
ATCATCAACCTCTAG
Gene >Hirsu2|10905
ATGGCGGCAAACGCCCTCGCCTCGGCACCCCCTTGGACGCCCGATGCCTCCTTTGCTGACCCTCTGCACCGCCCC
GTCTCGACCTTCGCCCCCTTCGTCCTGGCAGCGAGAGAAACGGCCACGACGCCGGGCAAGGCCCAGGCTTCCCAG
AACATCGGCATCGTCAGCTTCCTCACCGCCATCGGCGTCGCCCTGGCCATCTTTTCCTCTCAATTCCTGCTCTTC
ACGCTCCTGCGTAACAAGCTGGCCCGCATCTTGTGAGCACCCACTGCCAACTCGCCCAGGCGGCCGTCTCTAGAC
CAAGACCCCCTGCCCAGTCACTGACCGCCACGGCGCTGCAGTAAACCGAGAACATATCTTGTCCCCGAGCGGGAG
AGGACCGCATCGCCGCCCTCGAACATCGTGTCCCTAATCAGACGCATAGTCAAGTATGACGATCGCGAGGTCATC
AACAAGTGTGGCCTCGACGCATATTTCTTCCTTCGCTACCTCAAGACGCTCCTCGTCATCTTCATCCCCATCTGC
GCCGTCGTCTTGCCCGTTCTGATCCCGATCAACTACATTGGCGGCAAGGGGCACCAGGTCAACATCAACGACGCC
CAGAGAAAGTCGGACAACTCCACCCCGTCCGGCCTCGACACGCTGGCCTGGGGCAATGTCAGCTCAAAGAACACC
AGCCGCTACGGCGCCCACCTGGTCATGGCCATCCTCGTCGTCATCTGGGTCTGTTCCGTCTTCTTCTTCGAGCTG
CGCGTCTACATCAAGGTCCGCCAGGACTACCTCACCAGCGCCGAACACCGATTGCGGGCCTCGGCCACCACCGTC
CTCGTCAATTCCATCCCCAAGAAGTGGCTCAGCGAGGAGGCCCTCCTCGGCCTGTTCGACGTCTTCCCGGGCGGT
GTTCGGAACATTTGGCTGAACAGAGACCTGACCAAGCTGCTCGACAAGATCCACGAGAGACGCAGGGTTCACGAG
ATGCTCGAGTCGGCCGAGACGGACCTCATCAAGGCCGCCAAGAAGGCCCAGATCAAACAGAGGGACGCCGAAGAG
AGGCAGCAGAGGAGGAAGCAGAGCCTCAGGCCTCTCTCCAAGGAAGAGAAGGCCGCCCGCCAAGCGGAGGAAGAC
GCGGAAGCCAGCCGGCTGGCCAATAGCGATGAGGTGGCCCACGCCAGCCATGACGATCTCCCCCATACCCTGGAC
GGCGGCCTCCTCGAGTCGGAGCTGGAAATGCTCGAAAGGGATAGTTGCGAGCTGGAGACTGTCATCGAGGAAGGC
GGCAAGGCTTCTGGTGGCTTCGTCGCCCGCGGAGTCAAGAACCCGTTGTCCAAGGTGGGAAAGGGCCTCAAGGGT
GCTGCTACAAAGGCCGGCAACGAGGTCGACAGCACGCTCGGCCGAAGCCACGGCTTTTCCGGCAGTGGTGCGGCC
AGTAAGGAGACGGTCACGTTCGGCCCGTCCAGTACCGTCAAGGTCTACGGCGTCGACGAGAAAGACGGTCCGCCG
CGATTGTCGGAGCAACCGCTGGAGGCGGCTCGAACGCACTCGCGTGCCCCGTCCGCCGTCTCGGAAAACTCGACC
GTGGGCACGCAGAGAACCAGCCACGGCGCCATGCCCGGAAACACGGTCCGCAAACTCGTCAACGAGGACGACATG
TACGTGCACGGGCGGACGAGGTTCTGGGAGTTTTGGAAGCCCCCGTCGGGCGCGTATACGTCTCCCGTGCCTCAG
GGAGAGGCGGCCAGGGATTACATGGTCGGTAAGGCGACCAACGACAAGTCCGTCTGGCAGCGCTTCAAGACACGT
CTCCCTTTCATGGGCGAGGCCGAGGAGGCGTACGTGTACCCCGCGGCCCACTCCCCGGGCCGCAAGGCCGACGAG
GACGACGGAGCCGAGTGGGCAAGATATCTCAAGAAAAAGGACCGGCCGACGCATCGGCTGCCCCCCTTTGCCATC
CACTGGCTGCCCGGCCTCCCTCTCGTCAACAAGAAGGTGGACACTATTTACTGGTGCCGGGAGCAGCTCGCGCGG
CTCAACGTGGAGATCGAGGAGGACCAGAAGCACCCGGAACGGTTCCCGCTCATGTGCTCGGCCTTCGTCCAGTTC
AACCACCAGGTCGCGGCGCACATGGCCTGCCAGAGCGTCGTCCACCACATCCCGCGGCAGATGTCGCCGCGCATG
AACGAGATATCCCCCCGCGACGTCATCTGGGACAACATGGCCATCAGCTGGTGGCAGGAGTGGCTGCGGACCGCC
ATCGTCGCCATCGTCGTGGGGGCCATGATCTTCCTGTGGGCCATACCCGTCGCCTGGACGGCCGCCCTGAGCCAG
CTGGACTCCATCATCCACGACGCCGGCTGGCTCGGGTCCCTGCAGGACAACCAGGTGGCGGAGAACGTGGTCAAG
GCCGTGTCCGGTGTGCTGCCCGCGGCCGTGCTCGCGCTCCTGCTGATCCTGGTGCCCCTCATCCTCGGCCTGATG
GCCGAGTTCAAGGGCGCCAAGACGGGCGCCCAGAAGACGGAGTTTATCCAGATCTTTTACTTCGTCTTTCTTTTC
ATCCAAGTCTTCCTCATCGTCTCCATCGCGTCCTTCTTCGCCAAGTCGATCGGCGACTTTGTTAAGCGCATCACG
GAGCTGCAGTCGGTCAGCGCCGTCCTGGACCTGCTGGCCGAGAACCTGCCGGCGTCGGCCAACTACTTCTTCTCC
TACATGATCCTGCAGGCGCTGTCGACGAGCTCGGGCACGCTGCTCCAGATCGGCGCGCTGTTCATGTGGTTCGTG
CTGGCGCCCATGTTCGACAGCACGGCGCGGAGCAAGTGGCGGCGGAACACGACGCTCAACCAGATCGAATGGGGC
TCCTTCTTCCCGGTCTACACCAACTTCGCGTGCATCGGGCTGATCTACTGCGTCATCGCGCCCCTCATCTCCGTC
TTCGCCGTCATCACCTTCAGCCTGCTGTGGCTGGCCCAGAGATACGCGATGCTGTACGTCAACAGGTTCGAGACG
GACACCGGCGGCGTCCTCTACCCGCGGGCCATCAACCAGACCTTCACGGGCATCTACTTCATGGAGCTCTGCATG
GCCGGCCTGTTCTTCATCGCGCAAGACAACAAGGGCAGGCACACGTGCACGACGCACGGCATCGTCATGATCGTG
GTCTCGATCCTGACGCTCACCTACCAGGTCCTCCTCAACAAGTCCTTCTCCCCGCTCTTCCGCAACCTGCCGATC
ACGTTCGAGGACGAGGCGGTGCTCCGAGACGAAGCCTTCCAGCGGGCGCAGGACGTGCGGTTCGGCCTGCGGCGC
GACGAGCCACGGCTCGACCTGGGCCCGGCCGACAGGGGCGGCGAGGAGGGGCGGCCGAGCGTCGGGGAGGGCGCG
GGCCGGCTCATGGACGACGACGACCACCGCCGCGAGCAGGACCGCGGCGAGGTGCGGCGGGAACCGTCGATGCGC
CACCTGCGGGAACACGTCAAGCAGGTCGGCCACTGGGCCAAGGACGGCGGCAAGCAGGTCGGGACGTGGGCCAAG
GACGGCGGGCACCAGCTGCGCAAGCTGAAGAACATGGGCGACAACACCAAGGCGGTGCAGTACCGGCGGCGGCAG
CGGCAGCGCGACCTGGAGGCGCAGCGGGCCATCGGCGACGCGCTCTACGGCGGGGTGCACGACGACATCGAGGAC
CTGACGCCCGAGGAGCGCGGCCTGCTGACGCGGCACGCCTTCCAGCACTGCGCGCTGCGCGTGCGCCGGCCGACG
GTCTGGATCCCGCGCGACGACCTGGGCGTCAGCGACGACGAGATGGCCCGGACGCGCGCCTACAGCGAGCACATC
TGGATCAGCAACGAGGGTACGGCGCTCGACAGCAAGGTGCGCGTCGTCTACGGCAAGAACCCGCCCGACTTTTCC
GAGGTGGACATCATCAACCTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail