Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10904
Gene name
LocationContig_924:1524..3029
Strand+
Gene length (bp)1505
Transcript length (bp)1443
Coding sequence length (bp)1443
Protein length (aa) 481

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.7E-14 118 236
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 2.6E-14 119 460
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.1E-12 115 234
PF06028 DUF915 Alpha/beta hydrolase of unknown function (DUF915) 4.1E-06 157 216

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14249|CLD1_SCHPO probable cardiolipin-specific deacylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G10.03c PE=3 SV=1 56 472 1.0E-98
sp|P53264|CLD1_YEAST Cardiolipin-specific deacylase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLD1 PE=1 SV=1 91 467 1.0E-54
sp|O22975|LPAAT_ARATH 1-acylglycerol-3-phosphate O-acyltransferase OS=Arabidopsis thaliana GN=At4g24160 PE=1 SV=1 56 459 2.0E-54
sp|Q0J0A4|LPAAT_ORYSJ Probable 1-acylglycerol-3-phosphate O-acyltransferase OS=Oryza sativa subsp. japonica GN=Os09g0520200 PE=3 SV=3 56 462 2.0E-51
sp|Q8VD66|ABHD4_MOUSE Abhydrolase domain-containing protein 4 OS=Mus musculus GN=Abhd4 PE=1 SV=1 113 464 1.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14249|CLD1_SCHPO probable cardiolipin-specific deacylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G10.03c PE=3 SV=1 56 472 1.0E-98
sp|P53264|CLD1_YEAST Cardiolipin-specific deacylase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLD1 PE=1 SV=1 91 467 1.0E-54
sp|O22975|LPAAT_ARATH 1-acylglycerol-3-phosphate O-acyltransferase OS=Arabidopsis thaliana GN=At4g24160 PE=1 SV=1 56 459 2.0E-54
sp|Q0J0A4|LPAAT_ORYSJ Probable 1-acylglycerol-3-phosphate O-acyltransferase OS=Oryza sativa subsp. japonica GN=Os09g0520200 PE=3 SV=3 56 462 2.0E-51
sp|Q8VD66|ABHD4_MOUSE Abhydrolase domain-containing protein 4 OS=Mus musculus GN=Abhd4 PE=1 SV=1 113 464 1.0E-36
sp|Q5EA59|ABHD4_BOVIN Abhydrolase domain-containing protein 4 OS=Bos taurus GN=ABHD4 PE=2 SV=1 119 469 2.0E-36
sp|Q8TB40|ABHD4_HUMAN Abhydrolase domain-containing protein 4 OS=Homo sapiens GN=ABHD4 PE=2 SV=1 113 469 2.0E-36
sp|Q12385|ICT1_YEAST 1-acylglycerol-3-phosphate O-acyltransferase ICT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICT1 PE=3 SV=1 76 458 3.0E-32
sp|Q5EE05|ABHD5_PIG 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Sus scrofa GN=ABHD5 PE=2 SV=1 147 469 4.0E-27
sp|Q6QA69|ABHD5_RAT 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Rattus norvegicus GN=Abhd5 PE=1 SV=1 147 464 5.0E-27
sp|Q9DBL9|ABHD5_MOUSE 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Mus musculus GN=Abhd5 PE=1 SV=1 147 464 6.0E-27
sp|Q8WTS1|ABHD5_HUMAN 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Homo sapiens GN=ABHD5 PE=1 SV=1 147 469 1.0E-26
sp|Q5RBI4|ABHD5_PONAB 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Pongo abelii GN=ABHD5 PE=2 SV=1 147 469 1.0E-26
sp|Q04623|ECM18_YEAST Protein ECM18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM18 PE=1 SV=1 120 460 3.0E-24
sp|C7PDD8|PIP_CHIPD Proline iminopeptidase OS=Chitinophaga pinensis (strain ATCC 43595 / DSM 2588 / NCIB 11800 / UQM 2034) GN=Cpin_0261 PE=3 SV=2 101 229 4.0E-08
sp|P46542|PIP_LACDL Proline iminopeptidase OS=Lactobacillus delbrueckii subsp. lactis GN=pip PE=1 SV=1 111 229 6.0E-07
sp|P46544|PIP_LACDE Proline iminopeptidase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=pepIP PE=1 SV=2 111 229 8.0E-07
sp|Q1G8L9|PIP_LACDA Proline iminopeptidase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=pepIP PE=3 SV=1 111 229 8.0E-07
sp|P24640|LIP3_MORS1 Lipase 3 OS=Moraxella sp. (strain TA144) GN=lip3 PE=1 SV=1 117 252 1.0E-06
sp|O05420|PIP_ELIME Proline iminopeptidase OS=Elizabethkingia meningoseptica GN=fpaP PE=1 SV=1 105 227 2.0E-06
sp|A5FIF5|PIP_FLAJ1 Proline iminopeptidase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=fpaP PE=3 SV=2 105 227 2.0E-06
sp|P77044|MHPC_ECOLI 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain K12) GN=mhpC PE=1 SV=4 116 225 9.0E-06
sp|B1XBJ6|MHPC_ECODH 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain K12 / DH10B) GN=mhpC PE=3 SV=2 116 225 9.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2118 0.1369 0.1006 0.1181 0.7406 0.0345 0.3128 0.2857 0.3094 0.1146

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1413
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5828
Ophiocordyceps australis map64 (Brazil) OphauB2|1268
Ophiocordyceps camponoti-floridani Ophcf2|04053
Ophiocordyceps camponoti-rufipedis Ophun1|2155
Ophiocordyceps kimflemingae Ophio5|2298
Ophiocordyceps subramaniannii Hirsu2|10904 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10904
MSTTEAPVRPQQAHQAEAAEDPKRQQTAQRQPSMYFPLGYKDAAYQWWTSVTPPVAERNVLSLVPHLREAVENIT
SPSNTSDPFGTRIWKRSLVQLSGKNRALNEVCVERVGEDVDETLVMVHGYGAGLGFFYKNLEPITRIPGLKLYAL
DMLGMGNSSRPCFKIHAKDKEQQVIEAENWFIDALEEWRKARKIERFTLLGHSLGGYLAVSYAIKYPGHLKKLIL
ASPVGIPEDPFAVSASMPEPPESTLENEFTQDQQSVVERARASKKDAAPSAPKRPLPGWLVWLWDANISPFSIVR
MTGPLGPRFVSGWSSRRFNHLPAEEAQALHDYSFSIFKQKGSGEYALAYILAPGAYARRPIINRIHQVGRQVVGP
SDGAAPAAGAVRETGIPVVFMYGENDWMDVAGGLAAEERLKQASAEALLRGTEEQRRRENGSARVVVVPKAGHHL
YLDNPDFFNRVLREEVEATMQAEKRQRAAP*
Coding >Hirsu2|10904
ATGTCGACGACGGAGGCCCCCGTGCGCCCCCAGCAGGCGCACCAAGCCGAGGCGGCCGAGGACCCGAAACGGCAG
CAGACGGCCCAGCGCCAGCCCTCCATGTATTTCCCGCTGGGCTACAAGGACGCCGCCTACCAATGGTGGACCAGC
GTGACGCCGCCCGTCGCCGAACGAAACGTCCTCTCCCTCGTCCCCCACCTCCGCGAGGCCGTCGAAAACATCACG
AGCCCGTCCAACACGTCGGATCCCTTCGGCACGCGAATCTGGAAAAGGTCCCTCGTCCAGCTTTCCGGCAAGAAC
CGCGCCCTGAACGAGGTATGCGTCGAGCGCGTGGGCGAGGACGTCGACGAGACGCTCGTCATGGTCCACGGCTAC
GGCGCCGGCCTCGGCTTCTTCTACAAGAACTTGGAGCCCATCACGCGCATCCCCGGCCTCAAGCTCTACGCCCTC
GACATGCTGGGCATGGGCAACTCGTCGCGGCCCTGCTTCAAGATCCACGCCAAGGACAAGGAGCAGCAGGTGATC
GAGGCTGAGAACTGGTTCATCGACGCGCTTGAGGAGTGGCGCAAGGCACGCAAGATCGAACGCTTCACCCTGCTC
GGCCACTCTCTCGGCGGCTACCTGGCCGTCTCGTACGCCATCAAGTACCCGGGCCACCTCAAGAAGCTGATCCTG
GCCTCGCCCGTCGGCATCCCGGAGGACCCCTTCGCCGTCAGCGCCTCCATGCCCGAGCCGCCGGAATCGACCCTG
GAGAACGAGTTCACCCAGGACCAGCAATCCGTCGTCGAGCGCGCCAGGGCGTCCAAGAAGGACGCCGCGCCCAGC
GCACCCAAGCGGCCCCTGCCGGGCTGGCTCGTCTGGCTCTGGGACGCCAACATCTCGCCCTTCAGCATCGTCCGC
ATGACGGGCCCGCTGGGGCCGCGGTTCGTCTCCGGCTGGAGCTCGCGCCGCTTCAACCACCTGCCGGCCGAAGAG
GCCCAGGCCCTCCACGACTACTCCTTCTCCATCTTCAAGCAAAAGGGCAGCGGCGAGTACGCGCTGGCGTACATC
CTCGCGCCCGGCGCCTACGCGCGCCGGCCCATCATCAACCGCATCCACCAGGTCGGGCGGCAGGTTGTCGGCCCG
TCCGACGGGGCTGCCCCGGCCGCGGGGGCCGTCCGCGAGACGGGCATCCCCGTCGTCTTCATGTACGGCGAGAAC
GACTGGATGGACGTGGCGGGCGGGCTCGCCGCCGAGGAGCGGCTGAAGCAGGCCAGCGCCGAGGCCCTGCTGCGC
GGCACCGAGGAGCAGCGGCGGCGCGAGAACGGCAGCGCGCGCGTCGTCGTCGTCCCCAAGGCCGGCCACCACCTG
TACCTCGACAACCCGGACTTCTTCAACCGCGTCCTGCGCGAGGAAGTGGAGGCGACGATGCAGGCCGAGAAGCGC
CAGCGCGCCGCGCCGTGA
Transcript >Hirsu2|10904
ATGTCGACGACGGAGGCCCCCGTGCGCCCCCAGCAGGCGCACCAAGCCGAGGCGGCCGAGGACCCGAAACGGCAG
CAGACGGCCCAGCGCCAGCCCTCCATGTATTTCCCGCTGGGCTACAAGGACGCCGCCTACCAATGGTGGACCAGC
GTGACGCCGCCCGTCGCCGAACGAAACGTCCTCTCCCTCGTCCCCCACCTCCGCGAGGCCGTCGAAAACATCACG
AGCCCGTCCAACACGTCGGATCCCTTCGGCACGCGAATCTGGAAAAGGTCCCTCGTCCAGCTTTCCGGCAAGAAC
CGCGCCCTGAACGAGGTATGCGTCGAGCGCGTGGGCGAGGACGTCGACGAGACGCTCGTCATGGTCCACGGCTAC
GGCGCCGGCCTCGGCTTCTTCTACAAGAACTTGGAGCCCATCACGCGCATCCCCGGCCTCAAGCTCTACGCCCTC
GACATGCTGGGCATGGGCAACTCGTCGCGGCCCTGCTTCAAGATCCACGCCAAGGACAAGGAGCAGCAGGTGATC
GAGGCTGAGAACTGGTTCATCGACGCGCTTGAGGAGTGGCGCAAGGCACGCAAGATCGAACGCTTCACCCTGCTC
GGCCACTCTCTCGGCGGCTACCTGGCCGTCTCGTACGCCATCAAGTACCCGGGCCACCTCAAGAAGCTGATCCTG
GCCTCGCCCGTCGGCATCCCGGAGGACCCCTTCGCCGTCAGCGCCTCCATGCCCGAGCCGCCGGAATCGACCCTG
GAGAACGAGTTCACCCAGGACCAGCAATCCGTCGTCGAGCGCGCCAGGGCGTCCAAGAAGGACGCCGCGCCCAGC
GCACCCAAGCGGCCCCTGCCGGGCTGGCTCGTCTGGCTCTGGGACGCCAACATCTCGCCCTTCAGCATCGTCCGC
ATGACGGGCCCGCTGGGGCCGCGGTTCGTCTCCGGCTGGAGCTCGCGCCGCTTCAACCACCTGCCGGCCGAAGAG
GCCCAGGCCCTCCACGACTACTCCTTCTCCATCTTCAAGCAAAAGGGCAGCGGCGAGTACGCGCTGGCGTACATC
CTCGCGCCCGGCGCCTACGCGCGCCGGCCCATCATCAACCGCATCCACCAGGTCGGGCGGCAGGTTGTCGGCCCG
TCCGACGGGGCTGCCCCGGCCGCGGGGGCCGTCCGCGAGACGGGCATCCCCGTCGTCTTCATGTACGGCGAGAAC
GACTGGATGGACGTGGCGGGCGGGCTCGCCGCCGAGGAGCGGCTGAAGCAGGCCAGCGCCGAGGCCCTGCTGCGC
GGCACCGAGGAGCAGCGGCGGCGCGAGAACGGCAGCGCGCGCGTCGTCGTCGTCCCCAAGGCCGGCCACCACCTG
TACCTCGACAACCCGGACTTCTTCAACCGCGTCCTGCGCGAGGAAGTGGAGGCGACGATGCAGGCCGAGAAGCGC
CAGCGCGCCGCGCCGTGA
Gene >Hirsu2|10904
ATGTCGACGACGGAGGCCCCCGTGCGCCCCCAGCAGGCGCACCAAGCCGAGGCGGCCGAGGACCCGAAACGGCAG
CAGACGGCCCAGCGCCAGCCCTCCATGTATTTCCCGCTGGGCTACAAGGACGCCGCCTACCAATGGGTAAGCTGT
GCCGCTCTCCGCTCTCTCATATCTTTCCCCGTCGACTGACCGGATTTCCCCAGTGGACCAGCGTGACGCCGCCCG
TCGCCGAACGAAACGTCCTCTCCCTCGTCCCCCACCTCCGCGAGGCCGTCGAAAACATCACGAGCCCGTCCAACA
CGTCGGATCCCTTCGGCACGCGAATCTGGAAAAGGTCCCTCGTCCAGCTTTCCGGCAAGAACCGCGCCCTGAACG
AGGTATGCGTCGAGCGCGTGGGCGAGGACGTCGACGAGACGCTCGTCATGGTCCACGGCTACGGCGCCGGCCTCG
GCTTCTTCTACAAGAACTTGGAGCCCATCACGCGCATCCCCGGCCTCAAGCTCTACGCCCTCGACATGCTGGGCA
TGGGCAACTCGTCGCGGCCCTGCTTCAAGATCCACGCCAAGGACAAGGAGCAGCAGGTGATCGAGGCTGAGAACT
GGTTCATCGACGCGCTTGAGGAGTGGCGCAAGGCACGCAAGATCGAACGCTTCACCCTGCTCGGCCACTCTCTCG
GCGGCTACCTGGCCGTCTCGTACGCCATCAAGTACCCGGGCCACCTCAAGAAGCTGATCCTGGCCTCGCCCGTCG
GCATCCCGGAGGACCCCTTCGCCGTCAGCGCCTCCATGCCCGAGCCGCCGGAATCGACCCTGGAGAACGAGTTCA
CCCAGGACCAGCAATCCGTCGTCGAGCGCGCCAGGGCGTCCAAGAAGGACGCCGCGCCCAGCGCACCCAAGCGGC
CCCTGCCGGGCTGGCTCGTCTGGCTCTGGGACGCCAACATCTCGCCCTTCAGCATCGTCCGCATGACGGGCCCGC
TGGGGCCGCGGTTCGTCTCCGGCTGGAGCTCGCGCCGCTTCAACCACCTGCCGGCCGAAGAGGCCCAGGCCCTCC
ACGACTACTCCTTCTCCATCTTCAAGCAAAAGGGCAGCGGCGAGTACGCGCTGGCGTACATCCTCGCGCCCGGCG
CCTACGCGCGCCGGCCCATCATCAACCGCATCCACCAGGTCGGGCGGCAGGTTGTCGGCCCGTCCGACGGGGCTG
CCCCGGCCGCGGGGGCCGTCCGCGAGACGGGCATCCCCGTCGTCTTCATGTACGGCGAGAACGACTGGATGGACG
TGGCGGGCGGGCTCGCCGCCGAGGAGCGGCTGAAGCAGGCCAGCGCCGAGGCCCTGCTGCGCGGCACCGAGGAGC
AGCGGCGGCGCGAGAACGGCAGCGCGCGCGTCGTCGTCGTCCCCAAGGCCGGCCACCACCTGTACCTCGACAACC
CGGACTTCTTCAACCGCGTCCTGCGCGAGGAAGTGGAGGCGACGATGCAGGCCGAGAAGCGCCAGCGCGCCGCGC
CGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail