Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10902
Gene name
LocationContig_923:2839..4411
Strand+
Gene length (bp)1572
Transcript length (bp)1572
Coding sequence length (bp)1572
Protein length (aa) 524

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13854 Kelch_5 Kelch motif 1.7E-04 216 247
PF13854 Kelch_5 Kelch motif 2.5E-08 312 348
PF13854 Kelch_5 Kelch motif 1.4E-05 374 409
PF13854 Kelch_5 Kelch motif 1.2E-04 472 507
PF01344 Kelch_1 Kelch motif 1.8E-04 268 304
PF01344 Kelch_1 Kelch motif 2.6E-06 315 348
PF01344 Kelch_1 Kelch motif 8.3E-06 376 415
PF01344 Kelch_1 Kelch motif 1.9E-04 424 462
PF13418 Kelch_4 Galactose oxidase, central domain 3.8E-06 315 361
PF13418 Kelch_4 Galactose oxidase, central domain 3.6E-05 376 416
PF13418 Kelch_4 Galactose oxidase, central domain 4.5E-05 425 472
PF13964 Kelch_6 Kelch motif 2.4E-07 315 362
PF07646 Kelch_2 Kelch motif 1.4E-05 376 417
PF07646 Kelch_2 Kelch motif 1.8E-05 424 465

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 202 495 3.0E-25
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 202 495 8.0E-25
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 202 495 9.0E-25
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 202 495 4.0E-22
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 197 445 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 202 495 3.0E-25
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 202 495 8.0E-25
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 202 495 9.0E-25
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 202 495 4.0E-22
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 197 445 1.0E-20
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 198 495 1.0E-20
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 205 482 1.0E-19
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 262 500 9.0E-19
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 218 442 1.0E-18
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 274 507 2.0E-18
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 202 394 2.0E-18
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 252 512 2.0E-18
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 213 492 5.0E-18
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 149 494 5.0E-18
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 202 455 2.0E-17
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 218 463 4.0E-17
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 218 463 4.0E-17
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 187 482 5.0E-17
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 218 463 5.0E-17
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 213 492 7.0E-17
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 196 442 1.0E-16
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 185 397 2.0E-16
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 213 492 2.0E-16
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 213 492 2.0E-16
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 202 442 3.0E-16
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 192 480 5.0E-16
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 202 397 7.0E-16
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 217 504 7.0E-16
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 218 499 1.0E-15
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 202 479 1.0E-15
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 218 394 1.0E-15
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 195 495 1.0E-15
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 198 455 1.0E-15
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 198 492 2.0E-15
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 252 492 3.0E-15
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 252 512 3.0E-15
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 269 500 5.0E-15
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 213 480 5.0E-15
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 313 513 7.0E-15
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 227 433 7.0E-15
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 249 465 7.0E-15
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 202 364 7.0E-15
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 195 495 1.0E-14
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 209 440 1.0E-14
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 209 440 1.0E-14
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 213 480 1.0E-14
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 202 359 2.0E-14
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 252 493 2.0E-14
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 200 343 2.0E-14
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 197 409 5.0E-14
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 252 493 6.0E-14
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 209 440 8.0E-14
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 307 507 9.0E-14
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 202 508 1.0E-13
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 218 395 2.0E-13
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 301 512 2.0E-13
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 210 508 2.0E-13
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 316 507 2.0E-13
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 226 433 2.0E-13
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 251 492 3.0E-13
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 202 423 4.0E-13
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 207 350 4.0E-13
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 202 499 4.0E-13
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 279 507 4.0E-13
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 226 433 4.0E-13
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 207 507 7.0E-13
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 316 507 8.0E-13
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 274 513 1.0E-12
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 297 507 1.0E-12
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 297 507 1.0E-12
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 297 507 1.0E-12
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 218 346 1.0E-12
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 201 359 2.0E-12
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 213 464 3.0E-12
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 202 416 7.0E-12
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 226 482 7.0E-12
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 211 464 8.0E-12
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 252 521 1.0E-11
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 252 521 1.0E-11
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 227 482 1.0E-11
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 213 464 1.0E-11
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 211 464 1.0E-11
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 218 449 2.0E-11
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 314 512 2.0E-11
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 217 519 2.0E-11
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 252 521 2.0E-11
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 269 494 2.0E-11
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 202 430 2.0E-11
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 202 431 2.0E-11
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 271 502 3.0E-11
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 271 502 3.0E-11
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 202 457 3.0E-11
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 202 457 3.0E-11
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 204 461 3.0E-11
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 271 502 4.0E-11
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 202 395 4.0E-11
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 202 510 7.0E-11
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 202 395 7.0E-11
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 191 434 8.0E-11
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 202 395 8.0E-11
sp|Q9Y6Y0|NS1BP_HUMAN Influenza virus NS1A-binding protein OS=Homo sapiens GN=IVNS1ABP PE=1 SV=3 170 462 8.0E-11
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 227 456 8.0E-11
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 217 395 9.0E-11
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 211 464 9.0E-11
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 217 501 1.0E-10
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 313 511 1.0E-10
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 200 396 1.0E-10
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 211 464 1.0E-10
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 298 507 2.0E-10
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 298 507 2.0E-10
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 298 507 2.0E-10
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 202 510 2.0E-10
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 242 455 2.0E-10
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 226 482 3.0E-10
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 218 444 3.0E-10
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 374 523 4.0E-10
sp|Q920Q8|NS1BP_MOUSE Influenza virus NS1A-binding protein homolog OS=Mus musculus GN=Ivns1abp PE=1 SV=2 213 462 5.0E-10
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 240 506 6.0E-10
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 227 508 7.0E-10
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 271 502 1.0E-09
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 252 493 1.0E-09
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 277 510 3.0E-09
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 211 359 3.0E-09
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 202 497 3.0E-09
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 388 523 3.0E-09
sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 197 448 3.0E-09
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 192 409 4.0E-09
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 210 448 4.0E-09
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 197 335 5.0E-09
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 226 351 9.0E-09
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 201 335 9.0E-09
sp|Q60EX6|BSL1_ORYSJ Serine/threonine-protein phosphatase BSL1 homolog OS=Oryza sativa subsp. japonica GN=BSL1 PE=2 SV=1 240 442 9.0E-09
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 266 519 1.0E-08
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 191 493 1.0E-08
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 388 523 1.0E-08
sp|Q7ZVQ8|NS1BB_DANRE Influenza virus NS1A-binding protein homolog B OS=Danio rerio GN=ivns1abpb PE=2 SV=1 213 462 1.0E-08
sp|Q8L7U5|BSL1_ARATH Serine/threonine-protein phosphatase BSL1 OS=Arabidopsis thaliana GN=BSL1 PE=1 SV=2 240 506 1.0E-08
sp|Q70JS2|KELC_ANOST Ring canal kelch homolog OS=Anopheles stephensi GN=kel PE=2 SV=2 252 504 1.0E-08
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 191 493 2.0E-08
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 188 493 2.0E-08
sp|Q6DFU2|NS1BP_XENLA Influenza virus NS1A-binding protein homolog OS=Xenopus laevis GN=ivns1abp PE=2 SV=1 170 462 2.0E-08
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 202 453 2.0E-08
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 258 442 3.0E-08
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 188 493 4.0E-08
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 197 323 5.0E-08
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 202 448 5.0E-08
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 252 492 6.0E-08
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 248 442 6.0E-08
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 193 508 7.0E-08
sp|Q5RG82|NS1BA_DANRE Influenza virus NS1A-binding protein homolog A OS=Danio rerio GN=ivns1abpa PE=2 SV=1 213 462 7.0E-08
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 192 351 1.0E-07
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 191 333 1.0E-07
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 202 370 1.0E-07
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 248 442 1.0E-07
sp|Q7ZVQ8|NS1BB_DANRE Influenza virus NS1A-binding protein homolog B OS=Danio rerio GN=ivns1abpb PE=2 SV=1 321 507 1.0E-07
sp|Q6JEL3|KLH10_RAT Kelch-like protein 10 OS=Rattus norvegicus GN=Klhl10 PE=1 SV=1 227 495 1.0E-07
sp|Q9D5V2|KLH10_MOUSE Kelch-like protein 10 OS=Mus musculus GN=Klhl10 PE=1 SV=1 227 495 1.0E-07
sp|Q6JEL2|KLH10_HUMAN Kelch-like protein 10 OS=Homo sapiens GN=KLHL10 PE=1 SV=1 227 495 1.0E-07
sp|B4J045|KLHDB_DROGR Kelch-like protein diablo OS=Drosophila grimshawi GN=dbo PE=3 SV=1 224 496 1.0E-07
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 200 371 2.0E-07
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 191 333 2.0E-07
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 202 370 2.0E-07
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 262 493 2.0E-07
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 202 497 2.0E-07
sp|Q5RG82|NS1BA_DANRE Influenza virus NS1A-binding protein homolog A OS=Danio rerio GN=ivns1abpa PE=2 SV=1 321 502 2.0E-07
sp|B4L0G9|KLHDB_DROMO Kelch-like protein diablo OS=Drosophila mojavensis GN=dbo PE=3 SV=1 224 496 2.0E-07
sp|P15258|RAL2_SCHPO Protein ral2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ral2 PE=1 SV=1 258 414 2.0E-07
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 192 351 3.0E-07
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 192 351 3.0E-07
sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 295 493 3.0E-07
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 268 442 3.0E-07
sp|Q5U374|KLH12_DANRE Kelch-like protein 12 OS=Danio rerio GN=klhl12 PE=2 SV=2 213 463 3.0E-07
sp|B4LIG6|KLHDB_DROVI Kelch-like protein diablo OS=Drosophila virilis GN=dbo PE=3 SV=1 224 496 3.0E-07
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 197 448 4.0E-07
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 200 336 5.0E-07
sp|Q9Y6Y0|NS1BP_HUMAN Influenza virus NS1A-binding protein OS=Homo sapiens GN=IVNS1ABP PE=1 SV=3 308 519 5.0E-07
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 295 493 5.0E-07
sp|B4QLQ2|KLHDB_DROSI Kelch-like protein diablo OS=Drosophila simulans GN=dbo PE=3 SV=1 224 496 6.0E-07
sp|Q9P2G9|KLHL8_HUMAN Kelch-like protein 8 OS=Homo sapiens GN=KLHL8 PE=1 SV=4 316 496 7.0E-07
sp|B4PD06|KLHDB_DROYA Kelch-like protein diablo OS=Drosophila yakuba GN=dbo PE=3 SV=1 224 496 8.0E-07
sp|B4HIK1|KLHDB_DROSE Kelch-like protein diablo OS=Drosophila sechellia GN=dbo PE=3 SV=1 224 496 8.0E-07
sp|Q9VUU5|KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster GN=dbo PE=1 SV=1 224 496 8.0E-07
sp|B3NDN0|KLHDB_DROER Kelch-like protein diablo OS=Drosophila erecta GN=dbo PE=3 SV=1 224 496 8.0E-07
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 191 333 1.0E-06
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 191 333 1.0E-06
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 261 494 1.0E-06
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 374 508 1.0E-06
sp|Q8K430|KLH17_RAT Kelch-like protein 17 OS=Rattus norvegicus GN=Klhl17 PE=1 SV=1 223 462 1.0E-06
sp|Q6TDP3|KLH17_MOUSE Kelch-like protein 17 OS=Mus musculus GN=Klhl17 PE=1 SV=1 223 462 1.0E-06
sp|B4GRJ2|KLHDB_DROPE Kelch-like protein diablo OS=Drosophila persimilis GN=dbo PE=3 SV=1 224 496 1.0E-06
sp|B3M9V8|KLHDB_DROAN Kelch-like protein diablo OS=Drosophila ananassae GN=dbo PE=3 SV=2 224 496 1.0E-06
sp|Q8BZM0|KLH12_MOUSE Kelch-like protein 12 OS=Mus musculus GN=Klhl12 PE=2 SV=1 227 463 1.0E-06
sp|Q53G59|KLH12_HUMAN Kelch-like protein 12 OS=Homo sapiens GN=KLHL12 PE=1 SV=2 227 463 1.0E-06
sp|Q2M0J9|KLHDB_DROPS Kelch-like protein diablo OS=Drosophila pseudoobscura pseudoobscura GN=dbo PE=3 SV=2 224 496 1.0E-06
sp|Q8R2H4|KLH12_RAT Kelch-like protein 12 OS=Rattus norvegicus GN=Klhl12 PE=2 SV=2 227 463 1.0E-06
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 367 505 2.0E-06
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 182 417 2.0E-06
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 187 335 2.0E-06
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 232 394 2.0E-06
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 295 493 2.0E-06
sp|Q9P2G9|KLHL8_HUMAN Kelch-like protein 8 OS=Homo sapiens GN=KLHL8 PE=1 SV=4 216 463 2.0E-06
sp|P59280|KLHL8_MOUSE Kelch-like protein 8 OS=Mus musculus GN=Klhl8 PE=2 SV=2 316 496 2.0E-06
sp|G5ED84|KLHL8_CAEEL Kelch-like protein 8 OS=Caenorhabditis elegans GN=kel-8 PE=1 SV=1 300 496 2.0E-06
sp|B4MXW3|KLHDB_DROWI Kelch-like protein diablo OS=Drosophila willistoni GN=dbo PE=3 SV=1 224 496 2.0E-06
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 202 414 3.0E-06
sp|Q10579|SPE26_CAEEL Spermatocyte protein spe-26 OS=Caenorhabditis elegans GN=spe-26 PE=1 SV=1 227 493 3.0E-06
sp|Q6TDP4|KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens GN=KLHL17 PE=2 SV=1 223 462 3.0E-06
sp|Q7QGL0|KLHDB_ANOGA Kelch-like protein diablo OS=Anopheles gambiae GN=dbo PE=3 SV=4 328 445 3.0E-06
sp|Q16RL8|KLHDB_AEDAE Kelch-like protein diablo OS=Aedes aegypti GN=dbo PE=3 SV=1 328 445 3.0E-06
sp|B0WWP2|KLHDB_CULQU Kelch-like protein diablo OS=Culex quinquefasciatus GN=dbo PE=3 SV=2 328 445 3.0E-06
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 232 394 4.0E-06
sp|Q5ZKD9|KLH20_CHICK Kelch-like protein 20 OS=Gallus gallus GN=KLHL20 PE=2 SV=1 213 506 4.0E-06
sp|D3Z8N4|KLH20_RAT Kelch-like protein 20 OS=Rattus norvegicus GN=Klhl20 PE=3 SV=1 213 506 4.0E-06
sp|Q9Y2M5|KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens GN=KLHL20 PE=1 SV=4 213 506 4.0E-06
sp|Q08DK3|KLH20_BOVIN Kelch-like protein 20 OS=Bos taurus GN=KLHL20 PE=2 SV=3 213 506 4.0E-06
sp|Q920Q8|NS1BP_MOUSE Influenza virus NS1A-binding protein homolog OS=Mus musculus GN=Ivns1abp PE=1 SV=2 231 519 5.0E-06
sp|Q8VCK5|KLH20_MOUSE Kelch-like protein 20 OS=Mus musculus GN=Klhl20 PE=2 SV=2 213 506 5.0E-06
sp|Q04652|KELC_DROME Ring canal kelch protein OS=Drosophila melanogaster GN=kel PE=1 SV=4 252 504 5.0E-06
sp|Q6DFF6|KLH20_XENLA Kelch-like protein 20 OS=Xenopus laevis GN=klhl20 PE=2 SV=1 213 506 5.0E-06
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 295 493 6.0E-06
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 206 348 7.0E-06
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 206 348 7.0E-06
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 202 508 8.0E-06
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 202 394 8.0E-06
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 202 414 9.0E-06
sp|O94889|KLH18_HUMAN Kelch-like protein 18 OS=Homo sapiens GN=KLHL18 PE=1 SV=3 211 502 9.0E-06
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 202 414 1.0E-05
sp|Q9QYP0|MEGF8_RAT Multiple epidermal growth factor-like domains protein 8 OS=Rattus norvegicus GN=Megf8 PE=1 SV=2 209 445 1.0E-05
sp|Q9NR64|KLHL1_HUMAN Kelch-like protein 1 OS=Homo sapiens GN=KLHL1 PE=2 SV=1 226 496 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10902
MADSAGSAAGKSAEAPREVAKDRTVPSQKIAPSSPQASPRGAPGKAKRPESSSESEDETPPPSRSHPPGHLASKS
IADRQRKPSELAIRQRSQSAAQPSPVGRPTTAVGHQASKPAEAASSSAVDASHHGDEAEQGKKRDEAPASAAASA
GRGAQPAGTASRPPAATRVTRPARGQYTAAPPFHDPKKAPDVEPAPASGMYWSKALVCGAPHPNLRAHTATLIGS
NIYVFGGWDSRTCFNNMYVLDADAFYWYVPQLAGEIPMPLRAMTCTAIGKKLVLFGGGDGPTYYNGVYVLDTLNF
RWSRPRIVGDKMPCPRRAHTACLYKNGIYVFGGGDGDKALNDIWRLDVGDPAKMAWKLISSPDPSHPTSRDRRPK
ARGYHTANMSGSKLIVFGGSDGTECFDDVWIYDVDMHMWKSVDIAVTHRRLSHTATLVGSYLFVLGGHDGDEYCN
DVLLLNLVTMTWDKRKVYGKAPSGRGYHAALLHDSRLLMIGGFDGNEVFGDVMILELAVHAYYSQISHFTIDV*
Coding >Hirsu2|10902
ATGGCAGACTCGGCCGGGTCAGCAGCGGGCAAGTCTGCCGAGGCGCCGCGGGAGGTCGCCAAGGACCGGACGGTG
CCGTCGCAAAAGATCGCCCCCAGCTCGCCCCAGGCCTCGCCCCGGGGCGCGCCGGGCAAGGCGAAGAGGCCCGAA
TCCTCGAGCGAGTCCGAAGACGAGACGCCGCCGCCGTCGCGAAGCCACCCCCCGGGCCACCTGGCCAGCAAGAGC
ATCGCCGACCGCCAGCGCAAGCCGTCGGAGCTCGCCATCCGCCAGCGCTCCCAGTCGGCGGCGCAGCCGTCCCCG
GTCGGCAGGCCCACCACCGCCGTCGGCCACCAGGCGTCGAAGCCGGCCGAGGCCGCGAGCAGCAGCGCCGTCGAC
GCATCCCACCATGGCGACGAGGCAGAGCAGGGGAAGAAGCGGGACGAGGCGCCGGCCTCCGCCGCGGCGAGCGCC
GGCCGCGGAGCCCAGCCGGCGGGCACGGCCTCGCGTCCCCCGGCGGCCACGAGAGTGACCCGTCCGGCGCGGGGC
CAGTACACGGCCGCTCCGCCCTTCCACGACCCCAAGAAGGCGCCCGACGTCGAGCCGGCGCCGGCGTCTGGCATG
TACTGGTCCAAGGCGCTGGTCTGCGGCGCGCCTCACCCCAACCTGCGGGCGCACACGGCGACGCTCATCGGGTCC
AACATCTACGTCTTCGGCGGCTGGGATTCGCGGACCTGCTTCAACAACATGTACGTCCTCGACGCCGACGCCTTC
TACTGGTACGTCCCGCAGCTGGCCGGCGAAATACCCATGCCGCTGCGAGCCATGACGTGCACGGCCATCGGCAAG
AAGCTCGTGCTCTTTGGCGGCGGCGACGGGCCGACGTACTACAACGGCGTCTACGTGCTCGACACGCTCAACTTC
CGCTGGTCGAGGCCGCGCATCGTGGGCGACAAGATGCCGTGCCCGCGGCGGGCGCACACGGCCTGCCTCTACAAG
AACGGCATCTACGTCTTCGGCGGCGGCGACGGCGACAAGGCCCTCAACGACATCTGGCGCCTCGACGTCGGCGAT
CCCGCCAAGATGGCCTGGAAGCTCATCTCGAGCCCCGACCCGAGCCATCCGACGTCGCGCGACCGCCGCCCCAAG
GCGCGCGGCTACCACACGGCCAACATGAGCGGCAGCAAGCTCATCGTCTTCGGCGGCTCCGACGGCACCGAGTGC
TTCGACGACGTCTGGATCTACGACGTCGACATGCACATGTGGAAGTCGGTCGACATCGCCGTCACCCATCGTCGC
CTGTCCCACACGGCCACCCTCGTCGGCTCCTACCTCTTCGTGCTCGGCGGCCACGACGGCGACGAGTACTGCAAC
GACGTGCTGCTGCTCAACCTCGTCACCATGACCTGGGACAAGCGCAAGGTCTACGGCAAGGCCCCCAGCGGACGG
GGCTACCACGCGGCGCTGCTGCACGACAGCAGGCTGCTGATGATTGGCGGCTTCGACGGCAACGAAGTCTTTGGC
GATGTCATGATCCTCGAGCTGGCAGTCCACGCCTACTATTCGCAGATCAGCCACTTCACCATAGACGTTTAA
Transcript >Hirsu2|10902
ATGGCAGACTCGGCCGGGTCAGCAGCGGGCAAGTCTGCCGAGGCGCCGCGGGAGGTCGCCAAGGACCGGACGGTG
CCGTCGCAAAAGATCGCCCCCAGCTCGCCCCAGGCCTCGCCCCGGGGCGCGCCGGGCAAGGCGAAGAGGCCCGAA
TCCTCGAGCGAGTCCGAAGACGAGACGCCGCCGCCGTCGCGAAGCCACCCCCCGGGCCACCTGGCCAGCAAGAGC
ATCGCCGACCGCCAGCGCAAGCCGTCGGAGCTCGCCATCCGCCAGCGCTCCCAGTCGGCGGCGCAGCCGTCCCCG
GTCGGCAGGCCCACCACCGCCGTCGGCCACCAGGCGTCGAAGCCGGCCGAGGCCGCGAGCAGCAGCGCCGTCGAC
GCATCCCACCATGGCGACGAGGCAGAGCAGGGGAAGAAGCGGGACGAGGCGCCGGCCTCCGCCGCGGCGAGCGCC
GGCCGCGGAGCCCAGCCGGCGGGCACGGCCTCGCGTCCCCCGGCGGCCACGAGAGTGACCCGTCCGGCGCGGGGC
CAGTACACGGCCGCTCCGCCCTTCCACGACCCCAAGAAGGCGCCCGACGTCGAGCCGGCGCCGGCGTCTGGCATG
TACTGGTCCAAGGCGCTGGTCTGCGGCGCGCCTCACCCCAACCTGCGGGCGCACACGGCGACGCTCATCGGGTCC
AACATCTACGTCTTCGGCGGCTGGGATTCGCGGACCTGCTTCAACAACATGTACGTCCTCGACGCCGACGCCTTC
TACTGGTACGTCCCGCAGCTGGCCGGCGAAATACCCATGCCGCTGCGAGCCATGACGTGCACGGCCATCGGCAAG
AAGCTCGTGCTCTTTGGCGGCGGCGACGGGCCGACGTACTACAACGGCGTCTACGTGCTCGACACGCTCAACTTC
CGCTGGTCGAGGCCGCGCATCGTGGGCGACAAGATGCCGTGCCCGCGGCGGGCGCACACGGCCTGCCTCTACAAG
AACGGCATCTACGTCTTCGGCGGCGGCGACGGCGACAAGGCCCTCAACGACATCTGGCGCCTCGACGTCGGCGAT
CCCGCCAAGATGGCCTGGAAGCTCATCTCGAGCCCCGACCCGAGCCATCCGACGTCGCGCGACCGCCGCCCCAAG
GCGCGCGGCTACCACACGGCCAACATGAGCGGCAGCAAGCTCATCGTCTTCGGCGGCTCCGACGGCACCGAGTGC
TTCGACGACGTCTGGATCTACGACGTCGACATGCACATGTGGAAGTCGGTCGACATCGCCGTCACCCATCGTCGC
CTGTCCCACACGGCCACCCTCGTCGGCTCCTACCTCTTCGTGCTCGGCGGCCACGACGGCGACGAGTACTGCAAC
GACGTGCTGCTGCTCAACCTCGTCACCATGACCTGGGACAAGCGCAAGGTCTACGGCAAGGCCCCCAGCGGACGG
GGCTACCACGCGGCGCTGCTGCACGACAGCAGGCTGCTGATGATTGGCGGCTTCGACGGCAACGAAGTCTTTGGC
GATGTCATGATCCTCGAGCTGGCAGTCCACGCCTACTATTCGCAGATCAGCCACTTCACCATAGACGTTTAA
Gene >Hirsu2|10902
ATGGCAGACTCGGCCGGGTCAGCAGCGGGCAAGTCTGCCGAGGCGCCGCGGGAGGTCGCCAAGGACCGGACGGTG
CCGTCGCAAAAGATCGCCCCCAGCTCGCCCCAGGCCTCGCCCCGGGGCGCGCCGGGCAAGGCGAAGAGGCCCGAA
TCCTCGAGCGAGTCCGAAGACGAGACGCCGCCGCCGTCGCGAAGCCACCCCCCGGGCCACCTGGCCAGCAAGAGC
ATCGCCGACCGCCAGCGCAAGCCGTCGGAGCTCGCCATCCGCCAGCGCTCCCAGTCGGCGGCGCAGCCGTCCCCG
GTCGGCAGGCCCACCACCGCCGTCGGCCACCAGGCGTCGAAGCCGGCCGAGGCCGCGAGCAGCAGCGCCGTCGAC
GCATCCCACCATGGCGACGAGGCAGAGCAGGGGAAGAAGCGGGACGAGGCGCCGGCCTCCGCCGCGGCGAGCGCC
GGCCGCGGAGCCCAGCCGGCGGGCACGGCCTCGCGTCCCCCGGCGGCCACGAGAGTGACCCGTCCGGCGCGGGGC
CAGTACACGGCCGCTCCGCCCTTCCACGACCCCAAGAAGGCGCCCGACGTCGAGCCGGCGCCGGCGTCTGGCATG
TACTGGTCCAAGGCGCTGGTCTGCGGCGCGCCTCACCCCAACCTGCGGGCGCACACGGCGACGCTCATCGGGTCC
AACATCTACGTCTTCGGCGGCTGGGATTCGCGGACCTGCTTCAACAACATGTACGTCCTCGACGCCGACGCCTTC
TACTGGTACGTCCCGCAGCTGGCCGGCGAAATACCCATGCCGCTGCGAGCCATGACGTGCACGGCCATCGGCAAG
AAGCTCGTGCTCTTTGGCGGCGGCGACGGGCCGACGTACTACAACGGCGTCTACGTGCTCGACACGCTCAACTTC
CGCTGGTCGAGGCCGCGCATCGTGGGCGACAAGATGCCGTGCCCGCGGCGGGCGCACACGGCCTGCCTCTACAAG
AACGGCATCTACGTCTTCGGCGGCGGCGACGGCGACAAGGCCCTCAACGACATCTGGCGCCTCGACGTCGGCGAT
CCCGCCAAGATGGCCTGGAAGCTCATCTCGAGCCCCGACCCGAGCCATCCGACGTCGCGCGACCGCCGCCCCAAG
GCGCGCGGCTACCACACGGCCAACATGAGCGGCAGCAAGCTCATCGTCTTCGGCGGCTCCGACGGCACCGAGTGC
TTCGACGACGTCTGGATCTACGACGTCGACATGCACATGTGGAAGTCGGTCGACATCGCCGTCACCCATCGTCGC
CTGTCCCACACGGCCACCCTCGTCGGCTCCTACCTCTTCGTGCTCGGCGGCCACGACGGCGACGAGTACTGCAAC
GACGTGCTGCTGCTCAACCTCGTCACCATGACCTGGGACAAGCGCAAGGTCTACGGCAAGGCCCCCAGCGGACGG
GGCTACCACGCGGCGCTGCTGCACGACAGCAGGCTGCTGATGATTGGCGGCTTCGACGGCAACGAAGTCTTTGGC
GATGTCATGATCCTCGAGCTGGCAGTCCACGCCTACTATTCGCAGATCAGCCACTTCACCATAGACGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail