Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10900
Gene name
LocationContig_922:5810..10515
Strand-
Gene length (bp)4705
Transcript length (bp)4344
Coding sequence length (bp)4344
Protein length (aa) 1448

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 4.3E-43 429 639
PF01061 ABC2_membrane ABC-2 type transporter 1.1E-44 1121 1335
PF06422 PDR_CDR CDR ABC transporter 3.0E-32 665 750
PF00005 ABC_tran ABC transporter 1.1E-13 104 263
PF00005 ABC_tran ABC transporter 1.4E-17 817 968
PF14510 ABC_trans_N ABC-transporter N-terminal 8.2E-14 1 81
PF12698 ABC2_membrane_3 ABC-2 family transporter protein 9.0E-09 1218 1426

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 23 1446 0.0E+00
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 3 1446 0.0E+00
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 9 1445 0.0E+00
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 16 1447 0.0E+00
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 10 1445 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 23 1446 0.0E+00
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 3 1446 0.0E+00
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 9 1445 0.0E+00
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 16 1447 0.0E+00
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 10 1445 0.0E+00
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 10 1445 0.0E+00
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 1 1445 0.0E+00
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 4 1442 0.0E+00
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 9 1435 0.0E+00
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 32 1444 0.0E+00
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 29 1439 0.0E+00
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 56 1439 0.0E+00
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 102 1414 0.0E+00
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 14 1437 0.0E+00
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 22 1437 0.0E+00
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 18 1437 0.0E+00
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 6 1433 0.0E+00
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 29 1433 0.0E+00
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 18 1437 0.0E+00
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 54 1437 0.0E+00
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 32 1437 0.0E+00
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 54 1440 0.0E+00
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 113 1445 0.0E+00
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 113 1436 0.0E+00
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 76 1420 2.0E-160
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 50 1353 1.0E-141
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 83 1366 2.0E-138
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 97 1342 9.0E-136
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 95 1349 4.0E-133
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 74 1342 1.0E-132
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 92 1342 1.0E-130
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 74 1342 1.0E-129
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 97 1344 1.0E-129
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 79 1057 8.0E-129
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 97 1342 1.0E-128
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 84 1342 5.0E-128
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 76 1342 5.0E-128
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 76 1342 2.0E-127
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 87 1340 5.0E-127
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 95 1365 2.0E-126
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 95 1340 3.0E-126
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 87 1339 4.0E-126
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 87 1341 5.0E-125
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 97 1342 7.0E-125
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 98 1342 2.0E-124
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 97 1350 4.0E-124
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 72 1346 2.0E-123
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 97 1368 1.0E-122
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 97 1340 2.0E-122
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 97 1346 3.0E-122
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 97 1342 3.0E-122
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 40 1342 9.0E-122
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 50 1342 1.0E-121
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 97 1347 2.0E-121
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 81 1244 6.0E-121
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 97 1347 4.0E-120
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 97 1347 1.0E-119
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 89 1340 1.0E-119
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 95 1340 3.0E-118
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 97 1365 6.0E-116
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 95 1340 2.0E-115
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 83 1244 2.0E-113
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 97 1056 4.0E-111
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 99 1349 5.0E-109
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 79 1347 8.0E-105
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 802 1340 2.0E-77
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 786 1342 3.0E-75
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 815 1349 2.0E-74
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 811 1339 1.0E-72
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 802 1352 1.0E-71
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 763 1433 3.0E-68
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 785 1349 4.0E-67
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 816 1349 4.0E-63
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 81 724 3.0E-62
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 81 724 4.0E-61
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 804 1334 5.0E-60
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 804 1342 1.0E-59
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 794 1308 4.0E-58
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 794 1308 9.0E-57
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 804 1334 1.0E-56
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 797 1318 6.0E-55
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 772 1318 5.0E-54
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 796 1313 1.0E-53
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 91 654 3.0E-52
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 815 1427 7.0E-51
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 815 1427 8.0E-51
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 101 644 1.0E-50
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 794 1313 7.0E-50
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 797 1345 7.0E-50
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 101 660 1.0E-49
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 800 1224 2.0E-49
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 76 644 5.0E-49
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 801 1361 1.0E-48
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 800 1245 1.0E-48
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 812 1328 3.0E-48
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 815 1060 4.0E-48
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 96 644 9.0E-48
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 101 644 1.0E-47
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 804 1247 1.0E-47
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 101 644 2.0E-47
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 816 1346 3.0E-47
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 814 1328 4.0E-47
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 816 1345 6.0E-47
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 796 1334 2.0E-46
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 101 644 3.0E-46
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 816 1347 1.0E-45
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 800 1233 2.0E-45
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 97 639 3.0E-45
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 810 1328 4.0E-45
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 800 1233 7.0E-45
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 797 1328 1.0E-44
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 762 1250 1.0E-44
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 97 641 2.0E-44
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 812 1437 2.0E-44
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 810 1345 5.0E-44
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 749 1328 6.0E-44
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 797 1328 1.0E-43
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 797 1340 2.0E-43
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 793 1063 2.0E-43
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 800 1232 3.0E-43
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 784 1345 4.0E-43
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 798 1248 4.0E-43
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 775 1244 5.0E-43
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 784 1345 6.0E-43
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 797 1333 2.0E-42
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 99 683 2.0E-42
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 97 639 2.0E-42
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 814 1080 5.0E-42
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 799 1354 5.0E-42
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 798 1156 8.0E-42
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 812 1328 5.0E-41
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 794 1318 5.0E-41
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 94 641 6.0E-41
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 97 734 1.0E-40
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 90 643 3.0E-40
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 814 1334 4.0E-40
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 23 672 6.0E-40
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 816 1348 1.0E-39
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 807 1058 1.0E-39
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 810 1426 1.0E-39
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 814 1354 2.0E-39
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 91 639 2.0E-39
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 101 623 2.0E-39
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 812 1244 4.0E-39
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 812 1361 6.0E-39
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 86 641 1.0E-38
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 102 644 1.0E-38
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 807 1058 2.0E-38
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 814 1125 3.0E-38
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 101 623 3.0E-38
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 99 683 4.0E-38
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 97 669 5.0E-38
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 97 649 6.0E-38
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 790 1067 9.0E-38
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 798 1057 5.0E-37
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 813 1345 1.0E-36
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 97 735 1.0E-36
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 88 647 2.0E-36
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 102 635 2.0E-36
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 103 644 3.0E-36
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 102 642 5.0E-36
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 761 1244 9.0E-36
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 102 644 2.0E-35
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 103 644 4.0E-35
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 807 1070 5.0E-35
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 814 1283 6.0E-35
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 98 648 6.0E-35
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 807 1057 1.0E-34
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 46 644 1.0E-34
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 91 641 1.0E-34
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 102 650 2.0E-34
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 814 1243 4.0E-34
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 98 648 8.0E-34
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 814 1283 1.0E-33
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 102 735 2.0E-33
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 82 644 2.0E-33
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 86 641 2.0E-33
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 102 646 1.0E-32
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 814 1314 1.0E-32
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 102 646 1.0E-32
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 817 1057 4.0E-32
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 819 1057 5.0E-32
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 97 648 5.0E-32
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 97 639 5.0E-32
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 91 641 1.0E-31
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 102 729 1.0E-31
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 58 641 1.0E-31
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 819 1271 2.0E-31
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 102 664 2.0E-31
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 814 1058 5.0E-31
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 91 639 6.0E-31
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 102 643 7.0E-31
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 69 653 1.0E-30
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 88 661 3.0E-30
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 95 639 6.0E-30
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 102 352 6.0E-30
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 95 660 6.0E-30
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 87 641 6.0E-30
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 94 646 8.0E-30
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 95 646 8.0E-30
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 102 724 9.0E-30
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 816 1420 2.0E-29
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 808 1440 2.0E-29
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 91 647 2.0E-29
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 102 654 3.0E-29
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 101 646 4.0E-29
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 94 641 6.0E-29
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 815 1333 7.0E-29
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 94 641 8.0E-29
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 102 637 1.0E-28
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 102 639 4.0E-28
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 102 639 4.0E-28
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 102 637 7.0E-28
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 69 648 8.0E-28
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 62 634 1.0E-27
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 102 351 2.0E-27
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 102 650 5.0E-27
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 94 651 8.0E-27
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 94 651 9.0E-27
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 91 639 1.0E-26
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 94 645 3.0E-26
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 810 1328 5.0E-26
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 94 647 5.0E-26
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 102 650 8.0E-26
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 95 641 1.0E-25
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 94 735 1.0E-25
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 94 639 8.0E-25
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 827 1348 2.0E-24
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 91 654 2.0E-24
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 102 424 5.0E-24
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 89 639 9.0E-24
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 94 652 1.0E-23
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 786 1023 2.0E-23
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 53 639 2.0E-23
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 94 639 2.0E-23
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 94 641 4.0E-23
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 22 639 1.0E-22
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 94 651 3.0E-22
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 94 651 4.0E-22
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 99 639 5.0E-22
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 102 368 2.0E-21
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 808 1058 2.0E-21
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 101 384 3.0E-21
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 53 639 3.0E-21
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 810 1381 4.0E-21
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 810 1057 6.0E-21
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 91 647 5.0E-20
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 807 1328 2.0E-19
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 802 1057 5.0E-19
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 810 1362 6.0E-19
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 99 642 7.0E-19
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 816 1328 7.0E-19
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 806 1328 7.0E-19
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 97 358 1.0E-17
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 815 997 5.0E-17
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 92 329 1.0E-16
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 100 644 2.0E-16
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 72 639 2.0E-16
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 83 344 3.0E-16
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 792 985 8.0E-16
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 792 985 4.0E-15
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 102 358 5.0E-15
sp|P27675|GLNQ_GEOSE Glutamine transport ATP-binding protein GlnQ OS=Geobacillus stearothermophilus GN=glnQ PE=2 SV=1 816 1016 1.0E-14
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 813 1016 1.0E-14
sp|Q9RYZ3|PSTB_DEIRA Phosphate import ATP-binding protein PstB OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pstB PE=3 SV=1 806 998 2.0E-14
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 816 1016 2.0E-14
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 94 642 5.0E-14
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 773 997 7.0E-14
sp|P54954|YXEO_BACSU Probable amino-acid import ATP-binding protein YxeO OS=Bacillus subtilis (strain 168) GN=yxeO PE=1 SV=1 816 1016 1.0E-13
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 436 648 1.0E-13
sp|Q58206|Y796_METJA Uncharacterized ABC transporter ATP-binding protein MJ0796 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0796 PE=1 SV=1 817 1016 2.0E-13
sp|Q50801|Y583_METTM Putative ABC transporter ATP-binding protein MTBMA_c05830 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=MTBMA_c05830 PE=3 SV=2 817 1027 2.0E-13
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 815 1043 3.0E-13
sp|Q58488|ECFA_METJA Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ecfA PE=3 SV=1 816 997 4.0E-13
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 773 997 4.0E-13
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 816 1016 5.0E-13
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 802 1016 6.0E-13
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 797 1027 7.0E-13
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 776 1023 9.0E-13
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 776 1023 9.0E-13
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 776 1023 9.0E-13
sp|Q5KVK2|METN_GEOKA Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1 817 1025 1.0E-12
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 824 997 1.0E-12
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 812 1017 1.0E-12
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 802 1016 1.0E-12
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 810 1020 2.0E-12
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 810 1020 2.0E-12
sp|Q58903|Y1508_METJA Uncharacterized ABC transporter ATP-binding protein MJ1508 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1508 PE=3 SV=1 810 998 2.0E-12
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 802 1016 3.0E-12
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 802 1016 3.0E-12
sp|Q4AA74|ECFA2_MYCHJ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=ecfA2 PE=3 SV=1 805 1024 3.0E-12
sp|Q601T6|ECFA2_MYCH2 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Mycoplasma hyopneumoniae (strain 232) GN=ecfA2 PE=3 SV=1 805 1024 3.0E-12
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 802 1016 3.0E-12
sp|Q1J0N0|PSTB_DEIGD Phosphate import ATP-binding protein PstB OS=Deinococcus geothermalis (strain DSM 11300) GN=pstB PE=3 SV=1 803 998 3.0E-12
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 802 1016 3.0E-12
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 802 1016 3.0E-12
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 802 1016 3.0E-12
sp|Q4A8A1|ECFA2_MYCH7 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Mycoplasma hyopneumoniae (strain 7448) GN=ecfA2 PE=3 SV=1 805 1024 4.0E-12
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 802 1016 4.0E-12
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 802 1016 4.0E-12
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 802 1016 4.0E-12
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 816 1016 4.0E-12
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 802 1016 4.0E-12
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 816 1016 4.0E-12
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 783 1027 4.0E-12
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 802 1016 4.0E-12
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 814 1031 5.0E-12
sp|Q5PCG9|METN2_SALPA Methionine import ATP-binding protein MetN 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN2 PE=3 SV=1 797 1025 5.0E-12
sp|Q6D3Q6|METN2_PECAS Methionine import ATP-binding protein MetN 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN2 PE=3 SV=1 797 1025 5.0E-12
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 815 1023 5.0E-12
sp|O34677|GLNQ_BACSU Glutamine transport ATP-binding protein GlnQ OS=Bacillus subtilis (strain 168) GN=glnQ PE=2 SV=1 815 1016 5.0E-12
sp|Q9K619|BCEA_BACHD Bacitracin export ATP-binding protein BceA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bceA PE=3 SV=1 814 1034 6.0E-12
sp|Q83HT1|PSTB_TROW8 Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain TW08/27) GN=pstB PE=3 SV=1 813 1031 6.0E-12
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 776 1023 6.0E-12
sp|P45769|YHDZ_ECOLI Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ OS=Escherichia coli (strain K12) GN=yhdZ PE=3 SV=1 815 1016 8.0E-12
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 814 1016 8.0E-12
sp|Q8G7F4|PSTB_BIFLO Phosphate import ATP-binding protein PstB OS=Bifidobacterium longum (strain NCC 2705) GN=pstB PE=3 SV=1 817 1024 8.0E-12
sp|Q724C0|METN1_LISMF Methionine import ATP-binding protein MetN 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metN1 PE=3 SV=1 797 1016 8.0E-12
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 102 719 9.0E-12
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 816 1016 9.0E-12
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 783 1027 9.0E-12
sp|Q81IZ6|METN1_BACCR Methionine import ATP-binding protein MetN 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metN1 PE=3 SV=1 824 1017 9.0E-12
sp|Q51719|YCOBA_PROFR Putative ABC transporter ATP-binding protein in cobA 5'region OS=Propionibacterium freudenreichii subsp. shermanii PE=3 SV=1 815 998 1.0E-11
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 816 1016 1.0E-11
sp|Q92EZ6|METN1_LISIN Methionine import ATP-binding protein MetN 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metN1 PE=3 SV=1 797 1016 1.0E-11
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 798 1016 1.0E-11
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 824 997 1.0E-11
sp|Q83GE8|PSTB_TROWT Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain Twist) GN=pstB PE=3 SV=2 813 1031 2.0E-11
sp|O27739|ECFA_METTH Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ecfA PE=3 SV=1 824 1023 2.0E-11
sp|P37774|YECC_ECOLI L-cystine transport system ATP-binding protein YecC OS=Escherichia coli (strain K12) GN=yecC PE=3 SV=2 816 1016 2.0E-11
sp|Q57554|Y089_METJA Uncharacterized ABC transporter ATP-binding protein MJ0089 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0089 PE=3 SV=1 814 1043 2.0E-11
sp|O31711|YKNY_BACSU Uncharacterized ABC transporter ATP-binding protein YknY OS=Bacillus subtilis (strain 168) GN=yknY PE=1 SV=1 797 999 2.0E-11
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 811 1047 2.0E-11
sp|P39456|TCYC_BACSU L-cystine import ATP-binding protein TcyC OS=Bacillus subtilis (strain 168) GN=tcyC PE=1 SV=4 816 998 2.0E-11
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 824 997 2.0E-11
sp|Q8KFD6|Y391_CHLTE Putative ABC transporter ATP-binding protein CT0391 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0391 PE=3 SV=1 817 1025 2.0E-11
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 798 997 2.0E-11
sp|Q8Z8R5|METN2_SALTI Methionine import ATP-binding protein MetN 2 OS=Salmonella typhi GN=metN2 PE=3 SV=1 797 1025 2.0E-11
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 812 1016 2.0E-11
sp|Q3A9G5|METN_CARHZ Methionine import ATP-binding protein MetN OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metN PE=3 SV=1 815 998 2.0E-11
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 816 1016 2.0E-11
sp|Q8ZR89|METN2_SALTY Methionine import ATP-binding protein MetN 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN2 PE=3 SV=1 797 1025 3.0E-11
sp|O69063|HTXD_PSEST Hypophosphite import ATP-binding protein HtxD OS=Pseudomonas stutzeri GN=htxD PE=3 SV=1 802 1027 3.0E-11
sp|Q8YA75|METN1_LISMO Methionine import ATP-binding protein MetN 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metN1 PE=3 SV=1 797 1016 3.0E-11
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 816 1016 3.0E-11
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 447 663 4.0E-11
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 763 1027 4.0E-11
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 763 1027 4.0E-11
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 763 1027 4.0E-11
sp|Q9CK97|METN_PASMU Methionine import ATP-binding protein MetN OS=Pasteurella multocida (strain Pm70) GN=metN PE=3 SV=1 809 1027 4.0E-11
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 798 1027 4.0E-11
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 817 1016 4.0E-11
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 103 319 5.0E-11
sp|Q1GAN9|METN_LACDA Methionine import ATP-binding protein MetN OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=metN PE=3 SV=1 824 1025 5.0E-11
sp|Q04B25|METN_LACDB Methionine import ATP-binding protein MetN OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=metN PE=3 SV=1 824 1025 5.0E-11
sp|Q0A8P9|LOLD_ALKEH Lipoprotein-releasing system ATP-binding protein LolD OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=lolD PE=3 SV=1 816 1016 5.0E-11
sp|Q63H29|METN1_BACCZ Methionine import ATP-binding protein MetN 1 OS=Bacillus cereus (strain ZK / E33L) GN=metN1 PE=3 SV=1 824 1017 5.0E-11
sp|Q81VM2|METN1_BACAN Methionine import ATP-binding protein MetN 1 OS=Bacillus anthracis GN=metN1 PE=3 SV=1 824 1017 5.0E-11
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 748 1016 5.0E-11
sp|Q737I0|Y2668_BACC1 Putative ABC transporter ATP-binding protein BCE_2668 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_2668 PE=3 SV=1 814 1016 5.0E-11
sp|P48243|GLUA_CORGL Glutamate transport ATP-binding protein GluA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gluA PE=3 SV=2 817 1016 6.0E-11
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 810 1016 6.0E-11
sp|Q82G23|PSTB_STRAW Phosphate import ATP-binding protein PstB OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pstB PE=3 SV=1 815 995 6.0E-11
sp|Q6ADG4|PSTB_LEIXX Phosphate import ATP-binding protein PstB OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pstB PE=3 SV=1 817 1024 6.0E-11
sp|Q0BMC9|METN_FRATO Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=metN PE=3 SV=1 816 1020 6.0E-11
sp|Q2A3Z2|METN_FRATH Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. holarctica (strain LVS) GN=metN PE=3 SV=1 816 1020 6.0E-11
sp|Q81PZ8|Y2641_BACAN Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 OS=Bacillus anthracis GN=BA_2641 PE=3 SV=1 814 1016 6.0E-11
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 819 1027 7.0E-11
sp|Q043Y8|METN_LACGA Methionine import ATP-binding protein MetN OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=metN PE=3 SV=1 806 1027 7.0E-11
sp|Q2NHA1|ECFA_METST Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=ecfA PE=3 SV=1 817 997 7.0E-11
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 798 997 7.0E-11
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 798 997 8.0E-11
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 798 997 8.0E-11
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 811 1016 8.0E-11
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 802 1016 9.0E-11
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 816 1016 9.0E-11
sp|Q58967|Y1572_METJA Putative ABC transporter ATP-binding protein MJ1572 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1572 PE=3 SV=1 817 997 9.0E-11
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 806 1024 1.0E-10
sp|Q6HI76|Y2424_BACHK Putative ABC transporter ATP-binding protein BT9727_2424 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_2424 PE=3 SV=1 817 1016 1.0E-10
sp|Q9YG51|PSTB_AERPE Phosphate import ATP-binding protein PstB OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pstB PE=3 SV=1 806 1027 1.0E-10
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 810 1017 1.0E-10
sp|Q57S53|METN2_SALCH Methionine import ATP-binding protein MetN 2 OS=Salmonella choleraesuis (strain SC-B67) GN=metN2 PE=3 SV=1 803 1025 1.0E-10
sp|Q8RQL7|GLUA_COREF Glutamate transport ATP-binding protein GluA OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=gluA PE=3 SV=1 817 1016 1.0E-10
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 819 1023 1.0E-10
sp|Q1QVQ7|METN_CHRSD Methionine import ATP-binding protein MetN OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=metN PE=3 SV=1 817 998 1.0E-10
sp|Q8U4L3|Y068_PYRFU Putative ABC transporter ATP-binding protein PF0068 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0068 PE=3 SV=1 807 1027 1.0E-10
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 813 997 2.0E-10
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 813 1039 2.0E-10
sp|Q8TIW9|Y4021_METAC Putative ABC transporter ATP-binding protein MA_4021 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4021 PE=3 SV=1 816 1025 2.0E-10
sp|Q82VL9|LOLD_NITEU Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lolD PE=3 SV=1 816 1016 2.0E-10
sp|Q1LKJ2|NODI_CUPMC Nod factor export ATP-binding protein I OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nodI PE=3 SV=1 795 997 2.0E-10
sp|Q5WKL3|METN1_BACSK Methionine import ATP-binding protein MetN 1 OS=Bacillus clausii (strain KSM-K16) GN=metN1 PE=3 SV=1 817 1016 2.0E-10
sp|Q6XYT0|PSTB_SPIKU Phosphate import ATP-binding protein PstB OS=Spiroplasma kunkelii GN=pstB PE=3 SV=1 814 1037 2.0E-10
sp|Q02ME3|METN1_PSEAB Methionine import ATP-binding protein MetN 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metN1 PE=3 SV=1 817 1027 2.0E-10
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 817 1027 2.0E-10
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 806 1016 2.0E-10
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 827 1016 2.0E-10
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 817 1016 2.0E-10
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 810 997 2.0E-10
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 817 1031 3.0E-10
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 817 1031 3.0E-10
sp|A1JRI2|ZNUC_YERE8 Zinc import ATP-binding protein ZnuC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=znuC PE=3 SV=1 814 997 3.0E-10
sp|Q6ME20|METN_PARUW Methionine import ATP-binding protein MetN OS=Protochlamydia amoebophila (strain UWE25) GN=metN PE=3 SV=1 817 998 3.0E-10
sp|Q73F11|METN1_BACC1 Methionine import ATP-binding protein MetN 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN1 PE=3 SV=1 824 1017 3.0E-10
sp|Q6F9P2|METN2_ACIAD Methionine import ATP-binding protein MetN 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN2 PE=3 SV=1 797 998 3.0E-10
sp|Q5NFU5|METN_FRATT Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=metN PE=3 SV=2 816 1020 3.0E-10
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 810 1016 3.0E-10
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 783 1016 3.0E-10
sp|P42360|YSC1_STRGN Uncharacterized ABC transporter ATP-binding protein in scaA 5'region OS=Streptococcus gordonii PE=3 SV=1 817 1023 3.0E-10
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 810 1042 3.0E-10
sp|Q0TUN8|ECFA3_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA3 PE=1 SV=1 817 997 3.0E-10
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 804 1037 3.0E-10
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 1106 1434 4.0E-10
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 102 357 4.0E-10
sp|P45022|Y1078_HAEIN Probable amino-acid ABC transporter ATP-binding protein HI_1078 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1078 PE=3 SV=1 816 1016 4.0E-10
sp|P9WQM1|CYSA_MYCTU Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysA PE=1 SV=2 817 1016 4.0E-10
sp|P9WQM0|CYSA_MYCTO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysA PE=3 SV=2 817 1016 4.0E-10
sp|P0A4W3|CYSA_MYCBO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA PE=3 SV=2 817 1016 4.0E-10
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 824 984 4.0E-10
sp|Q14H97|METN_FRAT1 Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=metN PE=3 SV=2 816 1020 4.0E-10
sp|Q89LP2|METN_BRADU Methionine import ATP-binding protein MetN OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=metN PE=3 SV=1 810 1027 4.0E-10
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 827 1016 4.0E-10
sp|Q7WNT8|PHNC_BORBR Phosphonates import ATP-binding protein PhnC OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=phnC PE=3 SV=1 811 1024 4.0E-10
sp|Q119J0|PHNC1_TRIEI Phosphonates import ATP-binding protein PhnC 1 OS=Trichodesmium erythraeum (strain IMS101) GN=phnC1 PE=3 SV=1 817 1022 4.0E-10
sp|Q2J534|PSTB_FRASC Phosphate import ATP-binding protein PstB OS=Frankia sp. (strain CcI3) GN=pstB PE=3 SV=1 819 995 4.0E-10
sp|A1VZQ5|PEB1C_CAMJJ Probable ABC transporter ATP-binding protein PEB1C OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=peb1C PE=3 SV=1 816 1017 4.0E-10
sp|Q3IM24|PHNC2_NATPD Phosphonates import ATP-binding protein PhnC 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC2 PE=3 SV=1 817 1040 4.0E-10
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 812 1002 5.0E-10
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 812 1002 5.0E-10
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 813 1023 5.0E-10
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 813 1023 5.0E-10
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 811 1017 5.0E-10
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 815 1002 5.0E-10
sp|O06980|YVCR_BACSU Uncharacterized ABC transporter ATP-binding protein YvcR OS=Bacillus subtilis (strain 168) GN=yvcR PE=3 SV=1 821 1016 5.0E-10
sp|Q97KD5|METN_CLOAB Methionine import ATP-binding protein MetN OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=metN PE=3 SV=1 815 998 5.0E-10
sp|Q92LX3|METN_RHIME Methionine import ATP-binding protein MetN OS=Rhizobium meliloti (strain 1021) GN=metN PE=3 SV=1 817 998 6.0E-10
sp|Q8Y0X3|METN_RALSO Methionine import ATP-binding protein MetN OS=Ralstonia solanacearum (strain GMI1000) GN=metN PE=3 SV=1 817 1025 6.0E-10
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 811 1018 6.0E-10
sp|Q0P9X7|PEB1C_CAMJE Probable ABC transporter ATP-binding protein PEB1C OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=peb1C PE=3 SV=1 816 1017 6.0E-10
sp|P75612|Y081_MYCPN Putative ABC transporter ATP-binding protein MG065 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_081 PE=3 SV=1 816 1016 6.0E-10
sp|Q9EUS2|PSTB_STRGR Phosphate import ATP-binding protein PstB OS=Streptomyces griseus GN=pstB PE=3 SV=1 815 1030 7.0E-10
sp|Q81CT8|Y2655_BACCR Putative ABC transporter ATP-binding protein BC_2655 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_2655 PE=3 SV=2 814 1016 7.0E-10
sp|Q8PGE8|METN_XANAC Methionine import ATP-binding protein MetN OS=Xanthomonas axonopodis pv. citri (strain 306) GN=metN PE=3 SV=1 817 1027 7.0E-10
sp|Q7W148|PHNC_BORPA Phosphonates import ATP-binding protein PhnC OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=phnC PE=3 SV=1 811 1024 7.0E-10
sp|Q6YRJ4|Y020_ONYPE Putative ABC transporter ATP-binding protein PAM_020 OS=Onion yellows phytoplasma (strain OY-M) GN=PAM_020 PE=3 SV=1 797 1016 8.0E-10
sp|Q6D5H7|METN1_PECAS Methionine import ATP-binding protein MetN 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN1 PE=3 SV=1 810 1025 8.0E-10
sp|P44662|Y361_HAEIN Probable iron transport system ATP-binding protein HI_0361 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0361 PE=3 SV=1 817 997 8.0E-10
sp|P47311|Y065_MYCGE Putative ABC transporter ATP-binding protein MG065 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG065 PE=3 SV=1 816 1016 8.0E-10
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 817 1016 8.0E-10
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 813 997 8.0E-10
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 798 1016 8.0E-10
sp|Q07LR5|METN_RHOP5 Methionine import ATP-binding protein MetN OS=Rhodopseudomonas palustris (strain BisA53) GN=metN PE=3 SV=1 817 1023 9.0E-10
sp|P51241|ABCX_PORPU Probable ATP-dependent transporter ycf16 OS=Porphyra purpurea GN=ycf16 PE=3 SV=1 100 267 9.0E-10
sp|Q7VZ31|LOLD_BORPE Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=lolD PE=3 SV=1 816 1016 1.0E-09
sp|Q7W8T0|LOLD_BORPA Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=lolD PE=3 SV=1 816 1016 1.0E-09
sp|Q7WK40|LOLD_BORBR Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=lolD PE=3 SV=1 816 1016 1.0E-09
sp|Q0BZD8|PHNC_HYPNA Phosphonates import ATP-binding protein PhnC OS=Hyphomonas neptunium (strain ATCC 15444) GN=phnC PE=3 SV=1 824 1043 1.0E-09
sp|Q8R9L8|Y1589_CALS4 Putative ABC transporter ATP-binding protein TTE1589 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1589 PE=3 SV=1 797 1025 1.0E-09
sp|Q13LC4|PHNC_BURXL Phosphonates import ATP-binding protein PhnC OS=Burkholderia xenovorans (strain LB400) GN=phnC PE=3 SV=1 814 1023 1.0E-09
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 803 1017 1.0E-09
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 817 1039 1.0E-09
sp|Q2L219|LOLD_BORA1 Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella avium (strain 197N) GN=lolD PE=3 SV=1 815 1016 1.0E-09
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 813 1023 1.0E-09
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 813 1023 1.0E-09
sp|Q66AT7|ZNUC_YERPS Zinc import ATP-binding protein ZnuC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=znuC PE=3 SV=1 814 997 1.0E-09
sp|Q1CJG3|ZNUC_YERPN Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=znuC PE=3 SV=1 814 997 1.0E-09
sp|Q7CIC2|ZNUC_YERPE Zinc import ATP-binding protein ZnuC OS=Yersinia pestis GN=znuC PE=3 SV=1 814 997 1.0E-09
sp|Q1C812|ZNUC_YERPA Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=znuC PE=3 SV=1 814 997 1.0E-09
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 806 1016 1.0E-09
sp|Q31VE6|NIKE_SHIBS Nickel import ATP-binding protein NikE OS=Shigella boydii serotype 4 (strain Sb227) GN=nikE PE=3 SV=1 810 1027 1.0E-09
sp|Q0SWH9|ECFA2_CLOPS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain SM101 / Type A) GN=ecfA2 PE=3 SV=1 817 997 1.0E-09
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 810 1042 1.0E-09
sp|Q884I3|LOLD_PSESM Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=lolD PE=3 SV=1 824 1020 1.0E-09
sp|Q4KFA2|LOLD_PSEF5 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=lolD PE=3 SV=2 824 1016 1.0E-09
sp|Q04F14|METN1_OENOB Methionine import ATP-binding protein MetN 1 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=metN1 PE=3 SV=1 788 987 2.0E-09
sp|Q9I1C8|METN1_PSEAE Methionine import ATP-binding protein MetN 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metN1 PE=3 SV=1 817 1027 2.0E-09
sp|P0DJA1|LOLD_ZYMMO Lipoprotein-releasing system ATP-binding protein LolD OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=lolD PE=3 SV=1 88 316 2.0E-09
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 817 1040 2.0E-09
sp|Q5WJP0|METN2_BACSK Methionine import ATP-binding protein MetN 2 OS=Bacillus clausii (strain KSM-K16) GN=metN2 PE=3 SV=1 810 1025 2.0E-09
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 824 1016 2.0E-09
sp|Q6N798|METN2_RHOPA Methionine import ATP-binding protein MetN 2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=metN2 PE=3 SV=1 816 998 2.0E-09
sp|Q47L96|PSTB_THEFY Phosphate import ATP-binding protein PstB OS=Thermobifida fusca (strain YX) GN=pstB PE=3 SV=1 817 1033 2.0E-09
sp|Q2FRT7|ECFA2_METHJ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=ecfA2 PE=3 SV=1 817 1016 2.0E-09
sp|Q895C4|METN_CLOTE Methionine import ATP-binding protein MetN OS=Clostridium tetani (strain Massachusetts / E88) GN=metN PE=3 SV=1 808 1025 2.0E-09
sp|Q49W48|METN_STAS1 Methionine import ATP-binding protein MetN OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=metN PE=3 SV=1 808 987 2.0E-09
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 814 1016 2.0E-09
sp|Q7MJ01|LOLD_VIBVY Lipoprotein-releasing system ATP-binding protein LolD OS=Vibrio vulnificus (strain YJ016) GN=lolD PE=3 SV=2 816 1016 2.0E-09
sp|Q8DAV6|LOLD_VIBVU Lipoprotein-releasing system ATP-binding protein LolD OS=Vibrio vulnificus (strain CMCP6) GN=lolD PE=3 SV=1 816 1016 2.0E-09
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 824 1023 2.0E-09
sp|Q9KZW2|PSTB_STRCO Phosphate import ATP-binding protein PstB OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pstB PE=3 SV=1 817 995 2.0E-09
sp|Q52666|BZTD_RHOCB Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=bztD PE=3 SV=2 815 1016 2.0E-09
sp|Q47RE8|METN_THEFY Methionine import ATP-binding protein MetN OS=Thermobifida fusca (strain YX) GN=metN PE=3 SV=2 808 998 2.0E-09
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 810 1016 2.0E-09
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 812 1002 2.0E-09
sp|Q32AQ1|NIKE_SHIDS Nickel import ATP-binding protein NikE OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nikE PE=3 SV=1 810 1027 2.0E-09
sp|Q32HA3|ZNUC_SHIDS Zinc import ATP-binding protein ZnuC OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=znuC PE=3 SV=1 814 1013 2.0E-09
sp|Q9RKQ4|HMUV_STRCO Hemin import ATP-binding protein HmuV OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hmuV PE=3 SV=1 807 997 2.0E-09
sp|Q2W450|LOLD_MAGSA Lipoprotein-releasing system ATP-binding protein LolD OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=lolD PE=3 SV=1 824 1016 2.0E-09
sp|Q12NL5|LOLD_SHEDO Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lolD PE=3 SV=1 815 1016 2.0E-09
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 814 1044 3.0E-09
sp|Q9KD30|MNTB_BACHD Manganese transport system ATP-binding protein MntB OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mntB PE=3 SV=1 812 1015 3.0E-09
sp|Q2KVS6|MACB_BORA1 Macrolide export ATP-binding/permease protein MacB OS=Bordetella avium (strain 197N) GN=macB PE=3 SV=2 816 1016 3.0E-09
sp|Q9PHQ1|PSTB_CAMJE Phosphate import ATP-binding protein PstB OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pstB PE=3 SV=1 814 995 3.0E-09
sp|Q8X4L6|NIKE_ECO57 Nickel import ATP-binding protein NikE OS=Escherichia coli O157:H7 GN=nikE PE=3 SV=1 810 1027 3.0E-09
sp|O34900|TCYN_BACSU L-cystine import ATP-binding protein TcyN OS=Bacillus subtilis (strain 168) GN=tcyN PE=1 SV=1 816 1016 3.0E-09
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 703 997 3.0E-09
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 816 1016 3.0E-09
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 816 1016 3.0E-09
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 816 1016 3.0E-09
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 816 1016 3.0E-09
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 816 1016 3.0E-09
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 816 1016 3.0E-09
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 816 1016 3.0E-09
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 816 1016 3.0E-09
sp|Q7CHF8|METN2_YERPE Methionine import ATP-binding protein MetN 2 OS=Yersinia pestis GN=metN2 PE=3 SV=1 811 998 3.0E-09
sp|Q1C970|METN2_YERPA Methionine import ATP-binding protein MetN 2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=metN2 PE=3 SV=1 811 998 3.0E-09
sp|Q66CQ3|METN1_YERPS Methionine import ATP-binding protein MetN 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metN1 PE=3 SV=1 811 998 3.0E-09
sp|Q1CG91|METN1_YERPN Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=metN1 PE=3 SV=1 811 998 3.0E-09
sp|Q8DGZ3|PSTB_THEEB Phosphate import ATP-binding protein PstB OS=Thermosynechococcus elongatus (strain BP-1) GN=pstB PE=3 SV=1 815 1024 3.0E-09
sp|Q5FMM1|PHNC_LACAC Phosphonates import ATP-binding protein PhnC OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=phnC PE=3 SV=1 817 1032 3.0E-09
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 825 1016 3.0E-09
sp|Q48KI4|LOLD_PSE14 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=lolD PE=3 SV=1 824 1016 3.0E-09
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 817 1016 3.0E-09
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 106 318 4.0E-09
sp|Q3Z2L6|ZNUC_SHISS Zinc import ATP-binding protein ZnuC OS=Shigella sonnei (strain Ss046) GN=znuC PE=3 SV=1 814 1013 4.0E-09
sp|Q322E8|ZNUC_SHIBS Zinc import ATP-binding protein ZnuC OS=Shigella boydii serotype 4 (strain Sb227) GN=znuC PE=3 SV=1 814 1013 4.0E-09
sp|Q1RAS6|ZNUC_ECOUT Zinc import ATP-binding protein ZnuC OS=Escherichia coli (strain UTI89 / UPEC) GN=znuC PE=3 SV=1 814 1013 4.0E-09
sp|P0A9X1|ZNUC_ECOLI Zinc import ATP-binding protein ZnuC OS=Escherichia coli (strain K12) GN=znuC PE=1 SV=1 814 1013 4.0E-09
sp|P0A9X2|ZNUC_ECOL6 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=znuC PE=3 SV=1 814 1013 4.0E-09
sp|Q0TGX4|ZNUC_ECOL5 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=znuC PE=3 SV=1 814 1013 4.0E-09
sp|A1AC19|ZNUC_ECOK1 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O1:K1 / APEC GN=znuC PE=3 SV=1 814 1013 4.0E-09
sp|P0A9X3|ZNUC_ECO57 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O157:H7 GN=znuC PE=3 SV=1 814 1013 4.0E-09
sp|P42423|YXDL_BACSU ABC transporter ATP-binding protein YxdL OS=Bacillus subtilis (strain 168) GN=yxdL PE=2 SV=2 817 1030 4.0E-09
sp|Q83MC5|METN_SHIFL Methionine import ATP-binding protein MetN OS=Shigella flexneri GN=metN PE=3 SV=1 817 998 4.0E-09
sp|Q0T810|METN_SHIF8 Methionine import ATP-binding protein MetN OS=Shigella flexneri serotype 5b (strain 8401) GN=metN PE=3 SV=1 817 998 4.0E-09
sp|Q9K876|CYSA_BACHD Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1 110 360 4.0E-09
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 815 1016 4.0E-09
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 773 1024 4.0E-09
sp|Q8X5Q4|RBSA2_ECO57 Ribose import ATP-binding protein RbsA 2 OS=Escherichia coli O157:H7 GN=rbsA2 PE=3 SV=3 817 1016 4.0E-09
sp|Q5WDP1|METN3_BACSK Methionine import ATP-binding protein MetN 3 OS=Bacillus clausii (strain KSM-K16) GN=metN3 PE=3 SV=1 808 1025 4.0E-09
sp|Q8FV85|METN_BRUSU Methionine import ATP-binding protein MetN OS=Brucella suis biovar 1 (strain 1330) GN=metN PE=3 SV=2 817 1016 4.0E-09
sp|Q8YD40|METN_BRUME Methionine import ATP-binding protein MetN OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=metN PE=3 SV=1 817 1016 4.0E-09
sp|Q579H8|METN_BRUAB Methionine import ATP-binding protein MetN OS=Brucella abortus biovar 1 (strain 9-941) GN=metN PE=3 SV=2 817 1016 4.0E-09
sp|Q2YIV5|METN_BRUA2 Methionine import ATP-binding protein MetN OS=Brucella abortus (strain 2308) GN=metN PE=3 SV=2 817 1016 4.0E-09
sp|Q1R5D8|NIKE_ECOUT Nickel import ATP-binding protein NikE OS=Escherichia coli (strain UTI89 / UPEC) GN=nikE PE=3 SV=1 810 1027 4.0E-09
sp|Q8FCM9|NIKE_ECOL6 Nickel import ATP-binding protein NikE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nikE PE=3 SV=1 810 1027 4.0E-09
sp|Q0TBX8|NIKE_ECOL5 Nickel import ATP-binding protein NikE OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nikE PE=3 SV=1 810 1027 4.0E-09
sp|Q13W55|PSTB_BURXL Phosphate import ATP-binding protein PstB OS=Burkholderia xenovorans (strain LB400) GN=pstB PE=3 SV=1 817 1024 4.0E-09
sp|Q9WYI7|Y352_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0352 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0352 PE=3 SV=1 827 997 4.0E-09
sp|Q8E3S6|Y1680_STRA3 Putative ABC transporter ATP-binding protein gbs1680 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gbs1680 PE=3 SV=1 798 1031 4.0E-09
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 811 1016 4.0E-09
sp|O34979|YVRO_BACSU Uncharacterized ABC transporter ATP-binding protein YvrO OS=Bacillus subtilis (strain 168) GN=yvrO PE=3 SV=2 797 1016 4.0E-09
sp|Q8EPK1|METN1_OCEIH Methionine import ATP-binding protein MetN 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN1 PE=3 SV=2 810 1031 5.0E-09
sp|Q9L1C3|METN_STRCO Methionine import ATP-binding protein MetN OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=metN PE=3 SV=2 810 1027 5.0E-09
sp|O34814|FTSE_BACSU Cell division ATP-binding protein FtsE OS=Bacillus subtilis (strain 168) GN=ftsE PE=1 SV=1 815 997 5.0E-09
sp|Q1XDP6|ABCX_PYRYE Probable ATP-dependent transporter ycf16 OS=Pyropia yezoensis GN=ycf16 PE=3 SV=1 102 267 5.0E-09
sp|P0A9S0|FTSE_SHIFL Cell division ATP-binding protein FtsE OS=Shigella flexneri GN=ftsE PE=3 SV=1 814 1016 5.0E-09
sp|P0A9R7|FTSE_ECOLI Cell division ATP-binding protein FtsE OS=Escherichia coli (strain K12) GN=ftsE PE=1 SV=1 814 1016 5.0E-09
sp|P0A9R8|FTSE_ECOL6 Cell division ATP-binding protein FtsE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ftsE PE=3 SV=1 814 1016 5.0E-09
sp|P0A9R9|FTSE_ECO57 Cell division ATP-binding protein FtsE OS=Escherichia coli O157:H7 GN=ftsE PE=3 SV=1 814 1016 5.0E-09
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 797 998 5.0E-09
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 817 1016 5.0E-09
sp|Q6WB63|PHNC_ALCFA Phosphonates import ATP-binding protein PhnC OS=Alcaligenes faecalis GN=phnC PE=3 SV=1 815 1023 5.0E-09
sp|Q4ZV73|LOLD_PSEU2 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lolD PE=3 SV=2 824 1016 5.0E-09
sp|Q8TQW9|Y1418_METAC Putative ABC transporter ATP-binding protein MA_1418 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1418 PE=3 SV=1 817 998 5.0E-09
sp|P30750|METN_ECOLI Methionine import ATP-binding protein MetN OS=Escherichia coli (strain K12) GN=metN PE=1 SV=4 817 998 5.0E-09
sp|Q3K9F9|LOLD_PSEPF Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas fluorescens (strain Pf0-1) GN=lolD PE=3 SV=2 812 1016 5.0E-09
sp|Q4UMZ7|LOLD_RICFE Lipoprotein-releasing system ATP-binding protein LolD OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=lolD PE=3 SV=1 815 1016 5.0E-09
sp|Q92AF9|MNTB_LISIN Manganese transport system ATP-binding protein MntB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mntB PE=3 SV=1 817 1015 5.0E-09
sp|O59479|Y1815_PYRHO Putative ABC transporter ATP-binding protein PH1815 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1815 PE=3 SV=1 817 1016 5.0E-09
sp|Q032H3|ECFA2_LACLS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=ecfA2 PE=3 SV=1 815 997 6.0E-09
sp|Q0TLD2|METN_ECOL5 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=metN PE=3 SV=1 817 998 6.0E-09
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 817 1016 6.0E-09
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 817 1016 6.0E-09
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 817 1016 6.0E-09
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 817 1016 6.0E-09
sp|Q6NJ07|METN_CORDI Methionine import ATP-binding protein MetN OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metN PE=3 SV=1 817 1027 6.0E-09
sp|Q3Z5F8|METN_SHISS Methionine import ATP-binding protein MetN OS=Shigella sonnei (strain Ss046) GN=metN PE=3 SV=1 817 998 6.0E-09
sp|Q325U1|METN_SHIBS Methionine import ATP-binding protein MetN OS=Shigella boydii serotype 4 (strain Sb227) GN=metN PE=3 SV=1 817 998 6.0E-09
sp|Q1RFY9|METN_ECOUT Methionine import ATP-binding protein MetN OS=Escherichia coli (strain UTI89 / UPEC) GN=metN PE=3 SV=1 817 998 6.0E-09
sp|P63355|METN_ECOL6 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=metN PE=3 SV=1 817 998 6.0E-09
sp|P63356|METN_ECO57 Methionine import ATP-binding protein MetN OS=Escherichia coli O157:H7 GN=metN PE=3 SV=1 817 998 6.0E-09
sp|Q9X1Z1|ECFA1_THEMA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ecfA1 PE=1 SV=1 816 1016 6.0E-09
sp|Q47C66|LOLD_DECAR Lipoprotein-releasing system ATP-binding protein LolD OS=Dechloromonas aromatica (strain RCB) GN=lolD PE=3 SV=1 816 1016 6.0E-09
sp|Q0SFW6|METN2_RHOJR Methionine import ATP-binding protein MetN 2 OS=Rhodococcus jostii (strain RHA1) GN=metN2 PE=3 SV=1 817 1047 6.0E-09
sp|Q8ELA5|METN4_OCEIH Methionine import ATP-binding protein MetN 4 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN4 PE=3 SV=1 817 1016 6.0E-09
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 810 997 6.0E-09
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 97 279 7.0E-09
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 824 1016 7.0E-09
sp|Q3BNZ3|METN_XANC5 Methionine import ATP-binding protein MetN OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=metN PE=3 SV=1 817 1027 7.0E-09
sp|Q12B04|METN_POLSJ Methionine import ATP-binding protein MetN OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=metN PE=3 SV=1 813 1016 7.0E-09
sp|F8DT93|LOLD_ZYMMA Lipoprotein-releasing system ATP-binding protein LolD OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) GN=lolD PE=3 SV=1 88 316 7.0E-09
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 817 1017 7.0E-09
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 824 1016 7.0E-09
sp|Q329G7|RBSA_SHIDS Ribose import ATP-binding protein RbsA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rbsA PE=3 SV=1 817 1016 7.0E-09
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 810 997 7.0E-09
sp|Q82B58|Y5847_STRAW Putative ABC transporter ATP-binding protein SAV_5847 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_5847 PE=3 SV=1 797 1023 8.0E-09
sp|Q5NHP2|LOLD_FRATT Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=lolD PE=3 SV=1 816 1016 8.0E-09
sp|Q2A4V5|LOLD_FRATH Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. holarctica (strain LVS) GN=lolD PE=3 SV=1 816 1016 8.0E-09
sp|Q14J44|LOLD_FRAT1 Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=lolD PE=3 SV=1 816 1016 8.0E-09
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 815 1016 8.0E-09
sp|A2RI02|ECFA2_LACLM Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=ecfA2 PE=1 SV=1 815 997 8.0E-09
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 829 998 9.0E-09
sp|Q5ZUG5|METN_LEGPH Methionine import ATP-binding protein MetN OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=metN PE=3 SV=2 817 1020 9.0E-09
sp|Q5HVF4|PSTB_CAMJR Phosphate import ATP-binding protein PstB OS=Campylobacter jejuni (strain RM1221) GN=pstB PE=3 SV=1 814 995 9.0E-09
sp|A1B9Q7|UGPC_PARDP sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Paracoccus denitrificans (strain Pd 1222) GN=ugpC PE=3 SV=1 815 1016 9.0E-09
sp|P33594|NIKE_ECOLI Nickel import ATP-binding protein NikE OS=Escherichia coli (strain K12) GN=nikE PE=3 SV=2 810 1028 1.0E-08
sp|Q87RS1|METN_VIBPA Methionine import ATP-binding protein MetN OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=metN PE=1 SV=1 817 1027 1.0E-08
sp|Q32JQ8|METN_SHIDS Methionine import ATP-binding protein MetN OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=metN PE=3 SV=1 817 998 1.0E-08
sp|Q8XNY7|Y195_CLOPE Putative ABC transporter ATP-binding protein CPE0195 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE0195 PE=3 SV=1 817 997 1.0E-08
sp|Q8P4S7|METN_XANCP Methionine import ATP-binding protein MetN OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=metN PE=3 SV=1 817 1027 1.0E-08
sp|Q4UQD2|METN_XANC8 Methionine import ATP-binding protein MetN OS=Xanthomonas campestris pv. campestris (strain 8004) GN=metN PE=3 SV=1 817 1027 1.0E-08
sp|Q0BN75|LOLD_FRATO Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=lolD PE=3 SV=1 816 986 1.0E-08
sp|Q5MZ54|CMPC_SYNP6 Bicarbonate transport ATP-binding protein CmpC OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cmpC PE=3 SV=1 817 1016 1.0E-08
sp|Q55107|CMPC_SYNE7 Bicarbonate transport ATP-binding protein CmpC OS=Synechococcus elongatus (strain PCC 7942) GN=cmpC PE=1 SV=1 817 1016 1.0E-08
sp|A3DJK5|ECFA2_CLOTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ecfA2 PE=3 SV=1 807 1016 1.0E-08
sp|Q46TK4|PHNC_CUPPJ Phosphonates import ATP-binding protein PhnC OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=phnC PE=3 SV=1 802 1023 1.0E-08
sp|A0LM36|MACB_SYNFM Macrolide export ATP-binding/permease protein MacB OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=macB PE=3 SV=1 816 1000 1.0E-08
sp|Q5WVL8|METN_LEGPL Methionine import ATP-binding protein MetN OS=Legionella pneumophila (strain Lens) GN=metN PE=3 SV=1 817 1020 1.0E-08
sp|O31427|SKFE_BACSU SkfA peptide export ATP-binding protein SkfE OS=Bacillus subtilis (strain 168) GN=skfE PE=1 SV=1 824 1016 1.0E-08
sp|Q7N8M2|METN_PHOLL Methionine import ATP-binding protein MetN OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=metN PE=3 SV=1 817 998 1.0E-08
sp|Q52815|AAPP_RHIL3 General L-amino acid transport ATP-binding protein AapP OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=aapP PE=3 SV=1 816 1016 1.0E-08
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 815 1016 1.0E-08
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 797 1032 1.0E-08
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 703 997 1.0E-08
sp|Q6LN52|METN_PHOPR Methionine import ATP-binding protein MetN OS=Photobacterium profundum GN=metN PE=3 SV=2 817 998 1.0E-08
sp|Q3KCC5|FBPC_PSEPF Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf0-1) GN=fbpC PE=3 SV=1 817 1023 1.0E-08
sp|Q89EW7|MODC2_BRADU Molybdenum import ATP-binding protein ModC 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=modC2 PE=3 SV=1 829 1023 1.0E-08
sp|Q8P8V9|LOLD_XANCP Lipoprotein-releasing system ATP-binding protein LolD OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lolD PE=3 SV=2 816 1016 1.0E-08
sp|Q4UV71|LOLD_XANC8 Lipoprotein-releasing system ATP-binding protein LolD OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lolD PE=3 SV=2 816 1016 1.0E-08
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 97 279 2.0E-08
sp|Q81PZ8|Y2641_BACAN Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 OS=Bacillus anthracis GN=BA_2641 PE=3 SV=1 824 1016 2.0E-08
sp|Q6HI76|Y2424_BACHK Putative ABC transporter ATP-binding protein BT9727_2424 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_2424 PE=3 SV=1 824 1016 5.0E-08
sp|P9WQM1|CYSA_MYCTU Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysA PE=1 SV=2 103 369 8.0E-08
sp|P9WQM0|CYSA_MYCTO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysA PE=3 SV=2 103 369 8.0E-08
sp|P0A4W3|CYSA_MYCBO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA PE=3 SV=2 103 369 8.0E-08
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 817 1016 9.0E-08
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 113 314 1.0E-07
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 817 997 2.0E-07
sp|Q82B58|Y5847_STRAW Putative ABC transporter ATP-binding protein SAV_5847 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_5847 PE=3 SV=1 817 1016 2.0E-07
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 415 739 2.0E-07
sp|Q737I0|Y2668_BACC1 Putative ABC transporter ATP-binding protein BCE_2668 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_2668 PE=3 SV=1 805 1016 3.0E-07
sp|Q6NJ07|METN_CORDI Methionine import ATP-binding protein MetN OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metN PE=3 SV=1 95 319 4.0E-07
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 824 997 5.0E-07
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 110 320 6.0E-07
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 110 320 6.0E-07
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 103 313 7.0E-07
sp|Q8R9L8|Y1589_CALS4 Putative ABC transporter ATP-binding protein TTE1589 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1589 PE=3 SV=1 814 1016 1.0E-06
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 437 638 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0042626 ATPase activity, coupled to transmembrane movement of substances Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005524 ATP binding Yes
GO:0016887 ATPase activity Yes
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0051234 establishment of localization No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0022804 active transmembrane transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0042623 ATPase activity, coupled No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043492 ATPase activity, coupled to movement of substances No
GO:0022857 transmembrane transporter activity No
GO:0015405 P-P-bond-hydrolysis-driven transmembrane transporter activity No
GO:0006810 transport No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 448 470 22
2 482 504 22
3 524 546 22
4 558 577 19
5 587 609 22
6 709 731 22
7 1137 1159 22
8 1224 1246 22
9 1261 1283 22
10 1290 1309 19
11 1319 1341 22
12 1411 1433 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10900
LARSYSRTSAAVPGQNPFLAGSDSHLNPSSPNFSGREWAKAVVELVSHDGGSFRSTGVCFDSLNVYGYGESTDYQ
KDVANIWLSAAALARRFAGSGRQRIDILRNFDGLVRTGEMLVVLGPPGSGCSTFLKTIAGEMNGIYVDDGSYFNY
QGMTAREMHTDHRGEAIYTAEVDVHFPQLTVGDTLTFAARARQPRQLPEGLNRNEFANHLRDVVMAMFGISHTID
TRVGNEYVRGVSGGERKRVTISEAALSGAPLQCWDNSTRGLDSANAIEFCRTLRLQTELFNSTACVSIYQAPQSA
YDLFDKAAVLYEGRQIFFGRADAAKQYFINLGFECPPRQTTPDFLTSMTSSLERIVRPGFEAKAPRTPDEFADAW
RASAEYKALQKEIEEYKAAHPIDGPDAALFRASRRAQQAKGQRKRSPYTLSYAQQVQLCLWRGWKRLTGDPSLTV
GALIGNFAMALIIGSVFFNLNDTTSSFFQRGALLFFACLMNAFASALEILTLYAQRPIVEKHSRYALYHPSAEAI
ASMLCDMPYKIANTIVFNLTLYFMTNLRREPGAFFFFLLITFSTVLVMSMIFRTIASASRTLFQALVPAAILILD
LVIFTGFVLPKRYMLGWCKWLSYIDPLGYAFEALMVNEFHNRRFPCSQFVPSSTPTVPGSAGALAKYANVGPENR
ICNAVGSAQGQNFVDGDVYVKSSFDYEWDHRWRNFGFVIAFTAFFLLCYMVAAELVSEKKSKGEVLVYRRGHKPA
AAKHAEKRQRDPEAAMANIGPVVTAERSRAGAGGGKEAGMLQQQTSVFQWHDVCYDIKIKGEPRRILDNVDGWVK
PGTLTALMGVSGAGKTTLLDCLADRTSMGVITGEMLVDGKPRDMSFQRKTGYVQQQDLHLQTTTVREALNFSAVL
RQPAHIPRDEKLAYVEEVIKLLEMEEYADAVVGVPGEGLNVEQRKRLTIGVELAAKPPLLLFVDEPTSGLDSQTS
WAILDLLEKLTKAGQAVLCTIHQPSAMLFQRFDRLLFLAKGGKTVYFGDIGENSKTMTGYFERNGGHPCPAEANP
AEWMLEVIGAAPGTTTEIDWFKTWRASPEYGAVQAELDNIKQQKQGTTEAADDDDDDAGRYREFAAPFAVQLREN
LFRVFQQYWRTPVYIYAKTALCTLVALFIGFIFFKAPLTIQGLSNQMFSIFQLLTVFGQIVQQSMPQFVIQRSLY
EARERPSKVYSWKVFMLSQIIVELPWNALMALLMYVCWYYPVGLYANAVPTGDVAERGALTFLYLLMFMLFTGTF
STLVIAGFETAEAGGNLANLMFTLCLIFCGVLATPQSLPGFWIFLYRLSPFTYLVSGLLATGIGNAQVRCADNEL
LHFRPPANQTCGEYLTPFDRLAGGRVLRPEATDLCSYCPLADTNSFLAGVSSSYADRWRNFGILWAYIVFNIAAA
LFVYWLARMPKKSLGKGKKKKE*
Coding >Hirsu2|10900
CTGGCCCGCTCCTACTCGCGCACCTCGGCCGCCGTCCCGGGCCAGAACCCGTTCCTGGCCGGCTCCGACTCGCAC
CTCAACCCGAGCTCGCCCAACTTCAGCGGCCGCGAATGGGCCAAGGCCGTCGTCGAGCTCGTCTCCCACGACGGC
GGCTCCTTCCGCTCCACCGGCGTCTGCTTCGACAGCCTCAACGTCTACGGCTACGGCGAGTCCACCGACTACCAA
AAGGACGTCGCCAACATTTGGCTCTCCGCCGCCGCCCTCGCCCGCCGCTTCGCCGGCTCGGGCCGCCAGCGCATC
GACATCCTGCGCAACTTCGACGGCCTCGTCCGCACCGGCGAGATGCTCGTCGTCCTCGGCCCTCCCGGCTCCGGC
TGCTCCACCTTTCTCAAGACCATCGCCGGCGAGATGAACGGCATCTACGTCGACGACGGGTCCTACTTTAATTAC
CAAGGCATGACGGCCCGGGAGATGCATACGGACCACCGCGGCGAGGCCATCTACACCGCCGAGGTCGACGTCCAT
TTCCCCCAGCTGACCGTCGGCGATACCCTCACCTTCGCCGCACGGGCCCGCCAGCCCCGCCAGCTGCCCGAGGGT
CTGAACAGGAATGAGTTCGCCAACCACCTCCGCGACGTCGTCATGGCCATGTTCGGCATCTCCCACACCATCGAC
ACCCGCGTCGGCAACGAGTATGTCCGCGGCGTGTCGGGCGGCGAGCGCAAGCGCGTCACCATCTCCGAGGCCGCC
CTGTCTGGCGCCCCGTTGCAGTGCTGGGACAACTCGACCCGTGGCCTCGACTCGGCCAACGCCATCGAGTTCTGC
CGCACGCTGCGGCTGCAGACGGAGCTCTTCAACAGCACCGCCTGCGTCTCCATCTACCAGGCCCCCCAGAGCGCC
TACGACCTCTTCGACAAGGCCGCCGTCCTCTACGAGGGCCGCCAGATCTTCTTCGGCCGCGCCGACGCCGCCAAG
CAGTACTTCATCAACCTCGGCTTCGAGTGCCCGCCGCGCCAGACCACGCCCGACTTCCTCACCTCCATGACCTCC
TCCCTCGAGCGCATCGTCCGGCCAGGCTTCGAGGCCAAGGCCCCGCGCACCCCCGACGAGTTCGCCGACGCGTGG
AGGGCGAGCGCCGAGTACAAGGCTCTGCAGAAGGAGATTGAGGAATACAAGGCCGCCCACCCCATCGACGGCCCC
GACGCCGCCCTCTTCCGCGCCTCCCGCCGCGCTCAGCAGGCCAAGGGCCAGCGCAAAAGGTCCCCCTACACCCTG
TCCTACGCCCAGCAGGTGCAGCTGTGCCTCTGGCGCGGCTGGAAGCGCTTGACGGGCGACCCGAGCCTGACTGTC
GGCGCCCTCATCGGCAACTTTGCCATGGCCCTGATCATCGGCAGTGTCTTCTTCAATCTCAACGACACCACCTCG
AGCTTCTTCCAACGCGGCGCCCTGCTGTTCTTTGCCTGTCTGATGAATGCATTCGCCTCTGCTCTGGAGATCTTG
ACTCTGTATGCGCAACGGCCCATCGTGGAAAAGCATAGCCGATATGCCTTGTATCATCCGTCCGCCGAGGCCATT
GCGTCTATGCTATGCGACATGCCCTACAAGATTGCCAATACCATCGTCTTCAACCTGACCCTGTACTTCATGACC
AATCTACGCAGGGAGCCGGGCGCCTTCTTCTTCTTCCTGCTCATCACCTTCAGCACCGTCCTGGTCATGTCTATG
ATCTTCCGGACCATCGCATCGGCATCGCGCACCCTGTTCCAGGCCCTCGTCCCGGCCGCCATCCTGATCCTCGAT
CTGGTCATCTTCACCGGCTTCGTCCTTCCCAAGCGATACATGCTGGGCTGGTGCAAGTGGCTGAGCTACATCGAC
CCCTTGGGCTACGCCTTCGAGGCCCTCATGGTCAACGAGTTTCACAACCGCCGCTTCCCGTGCTCGCAGTTCGTG
CCCTCGTCGACGCCGACCGTACCCGGGTCCGCCGGCGCGCTCGCCAAGTACGCCAACGTGGGCCCCGAGAACCGC
ATCTGCAACGCCGTCGGCTCCGCCCAGGGCCAGAACTTCGTCGACGGCGACGTCTACGTCAAGTCAAGCTTCGAC
TACGAATGGGACCACCGCTGGCGCAACTTTGGCTTCGTCATCGCCTTCACCGCCTTCTTCCTCCTCTGCTACATG
GTGGCCGCCGAGCTGGTGTCGGAGAAGAAGTCCAAGGGCGAGGTCCTGGTCTACCGCCGGGGCCACAAACCCGCC
GCCGCCAAGCACGCCGAGAAGAGGCAGCGCGATCCCGAGGCCGCCATGGCCAACATCGGCCCCGTCGTCACGGCG
GAGAGGAGCCGCGCCGGCGCCGGCGGCGGCAAGGAGGCCGGCATGCTCCAGCAGCAGACGTCCGTCTTCCAGTGG
CACGACGTCTGCTACGACATCAAGATCAAGGGCGAGCCGCGGCGCATCCTGGACAACGTGGACGGGTGGGTCAAG
CCCGGCACCCTCACCGCCCTCATGGGCGTGTCCGGGGCCGGCAAGACGACGCTGCTGGACTGCCTGGCGGACCGC
ACGTCGATGGGCGTCATCACGGGTGAGATGCTCGTCGACGGCAAGCCCCGCGATATGTCCTTCCAGCGCAAGACC
GGTTACGTCCAGCAGCAGGACCTGCACCTGCAGACGACGACGGTCCGCGAGGCCCTCAACTTCAGCGCCGTCCTG
CGTCAGCCCGCTCATATACCTAGGGACGAGAAGCTAGCCTACGTCGAGGAGGTCATCAAGCTCCTAGAGATGGAA
GAGTATGCCGATGCCGTCGTCGGCGTCCCGGGCGAGGGTCTGAACGTCGAGCAGCGCAAGCGCCTCACCATCGGG
GTCGAGCTGGCCGCCAAGCCGCCGCTCCTGCTCTTCGTCGACGAGCCGACGTCGGGCCTCGACTCGCAGACGTCC
TGGGCCATCCTGGACCTGCTCGAGAAGCTGACCAAGGCGGGCCAGGCCGTCCTGTGCACCATCCACCAGCCGTCG
GCCATGCTGTTCCAGCGCTTCGACCGGCTCCTCTTCCTGGCCAAGGGCGGCAAGACGGTCTACTTCGGCGACATC
GGCGAGAACTCCAAGACGATGACGGGCTACTTCGAGCGCAACGGCGGGCACCCCTGTCCCGCCGAGGCGAATCCG
GCCGAGTGGATGCTCGAGGTGATCGGGGCGGCGCCCGGAACGACGACGGAGATCGACTGGTTCAAGACGTGGCGA
GCGAGCCCCGAGTACGGGGCCGTGCAGGCCGAGCTCGACAACATCAAGCAGCAGAAGCAGGGGACGACCGAGGCC
GCCGACGACGACGACGACGACGCCGGGCGGTACCGCGAGTTCGCGGCGCCGTTCGCGGTGCAGCTGCGGGAGAAC
CTGTTCCGGGTCTTCCAGCAGTACTGGCGCACGCCGGTCTACATCTACGCCAAGACGGCGCTCTGCACGCTCGTC
GCCCTCTTCATCGGCTTCATCTTCTTCAAGGCGCCGCTGACGATCCAGGGGCTGAGCAACCAGATGTTCTCCATC
TTCCAGCTGCTGACCGTGTTCGGGCAGATCGTGCAGCAGTCGATGCCGCAGTTCGTGATCCAGCGGTCGCTGTAC
GAGGCGCGCGAGCGGCCGTCCAAGGTGTACTCGTGGAAGGTCTTCATGCTGTCGCAGATCATCGTGGAGCTGCCG
TGGAACGCGCTGATGGCGCTGCTCATGTACGTCTGCTGGTACTACCCGGTCGGGCTGTACGCCAACGCGGTGCCG
ACGGGCGACGTGGCCGAGCGCGGCGCGCTCACCTTCCTGTACCTGCTCATGTTCATGCTCTTCACCGGCACCTTC
TCGACGCTCGTCATCGCCGGCTTCGAGACGGCCGAGGCCGGCGGCAACCTGGCCAACCTCATGTTCACCCTCTGC
CTCATCTTCTGCGGCGTCCTCGCCACGCCCCAGTCGCTGCCGGGCTTCTGGATCTTCCTCTACCGCCTCTCGCCC
TTCACCTACCTCGTCTCGGGCCTGCTGGCGACGGGCATCGGCAACGCCCAGGTCCGCTGCGCCGACAACGAGCTG
CTGCACTTCCGCCCGCCCGCCAACCAGACGTGCGGCGAGTACCTGACGCCCTTCGACCGCCTCGCCGGCGGCCGC
GTCCTGCGGCCCGAGGCCACCGACCTCTGCTCCTACTGCCCGCTCGCCGACACCAACTCCTTCCTCGCCGGCGTC
AGCAGCAGCTACGCCGACCGCTGGCGCAACTTTGGCATCCTCTGGGCCTACATCGTCTTCAACATCGCCGCCGCC
CTCTTCGTCTACTGGCTGGCGCGCATGCCCAAGAAGAGCCTCGGCAAGGGCAAGAAGAAGAAGGAGTAG
Transcript >Hirsu2|10900
CTGGCCCGCTCCTACTCGCGCACCTCGGCCGCCGTCCCGGGCCAGAACCCGTTCCTGGCCGGCTCCGACTCGCAC
CTCAACCCGAGCTCGCCCAACTTCAGCGGCCGCGAATGGGCCAAGGCCGTCGTCGAGCTCGTCTCCCACGACGGC
GGCTCCTTCCGCTCCACCGGCGTCTGCTTCGACAGCCTCAACGTCTACGGCTACGGCGAGTCCACCGACTACCAA
AAGGACGTCGCCAACATTTGGCTCTCCGCCGCCGCCCTCGCCCGCCGCTTCGCCGGCTCGGGCCGCCAGCGCATC
GACATCCTGCGCAACTTCGACGGCCTCGTCCGCACCGGCGAGATGCTCGTCGTCCTCGGCCCTCCCGGCTCCGGC
TGCTCCACCTTTCTCAAGACCATCGCCGGCGAGATGAACGGCATCTACGTCGACGACGGGTCCTACTTTAATTAC
CAAGGCATGACGGCCCGGGAGATGCATACGGACCACCGCGGCGAGGCCATCTACACCGCCGAGGTCGACGTCCAT
TTCCCCCAGCTGACCGTCGGCGATACCCTCACCTTCGCCGCACGGGCCCGCCAGCCCCGCCAGCTGCCCGAGGGT
CTGAACAGGAATGAGTTCGCCAACCACCTCCGCGACGTCGTCATGGCCATGTTCGGCATCTCCCACACCATCGAC
ACCCGCGTCGGCAACGAGTATGTCCGCGGCGTGTCGGGCGGCGAGCGCAAGCGCGTCACCATCTCCGAGGCCGCC
CTGTCTGGCGCCCCGTTGCAGTGCTGGGACAACTCGACCCGTGGCCTCGACTCGGCCAACGCCATCGAGTTCTGC
CGCACGCTGCGGCTGCAGACGGAGCTCTTCAACAGCACCGCCTGCGTCTCCATCTACCAGGCCCCCCAGAGCGCC
TACGACCTCTTCGACAAGGCCGCCGTCCTCTACGAGGGCCGCCAGATCTTCTTCGGCCGCGCCGACGCCGCCAAG
CAGTACTTCATCAACCTCGGCTTCGAGTGCCCGCCGCGCCAGACCACGCCCGACTTCCTCACCTCCATGACCTCC
TCCCTCGAGCGCATCGTCCGGCCAGGCTTCGAGGCCAAGGCCCCGCGCACCCCCGACGAGTTCGCCGACGCGTGG
AGGGCGAGCGCCGAGTACAAGGCTCTGCAGAAGGAGATTGAGGAATACAAGGCCGCCCACCCCATCGACGGCCCC
GACGCCGCCCTCTTCCGCGCCTCCCGCCGCGCTCAGCAGGCCAAGGGCCAGCGCAAAAGGTCCCCCTACACCCTG
TCCTACGCCCAGCAGGTGCAGCTGTGCCTCTGGCGCGGCTGGAAGCGCTTGACGGGCGACCCGAGCCTGACTGTC
GGCGCCCTCATCGGCAACTTTGCCATGGCCCTGATCATCGGCAGTGTCTTCTTCAATCTCAACGACACCACCTCG
AGCTTCTTCCAACGCGGCGCCCTGCTGTTCTTTGCCTGTCTGATGAATGCATTCGCCTCTGCTCTGGAGATCTTG
ACTCTGTATGCGCAACGGCCCATCGTGGAAAAGCATAGCCGATATGCCTTGTATCATCCGTCCGCCGAGGCCATT
GCGTCTATGCTATGCGACATGCCCTACAAGATTGCCAATACCATCGTCTTCAACCTGACCCTGTACTTCATGACC
AATCTACGCAGGGAGCCGGGCGCCTTCTTCTTCTTCCTGCTCATCACCTTCAGCACCGTCCTGGTCATGTCTATG
ATCTTCCGGACCATCGCATCGGCATCGCGCACCCTGTTCCAGGCCCTCGTCCCGGCCGCCATCCTGATCCTCGAT
CTGGTCATCTTCACCGGCTTCGTCCTTCCCAAGCGATACATGCTGGGCTGGTGCAAGTGGCTGAGCTACATCGAC
CCCTTGGGCTACGCCTTCGAGGCCCTCATGGTCAACGAGTTTCACAACCGCCGCTTCCCGTGCTCGCAGTTCGTG
CCCTCGTCGACGCCGACCGTACCCGGGTCCGCCGGCGCGCTCGCCAAGTACGCCAACGTGGGCCCCGAGAACCGC
ATCTGCAACGCCGTCGGCTCCGCCCAGGGCCAGAACTTCGTCGACGGCGACGTCTACGTCAAGTCAAGCTTCGAC
TACGAATGGGACCACCGCTGGCGCAACTTTGGCTTCGTCATCGCCTTCACCGCCTTCTTCCTCCTCTGCTACATG
GTGGCCGCCGAGCTGGTGTCGGAGAAGAAGTCCAAGGGCGAGGTCCTGGTCTACCGCCGGGGCCACAAACCCGCC
GCCGCCAAGCACGCCGAGAAGAGGCAGCGCGATCCCGAGGCCGCCATGGCCAACATCGGCCCCGTCGTCACGGCG
GAGAGGAGCCGCGCCGGCGCCGGCGGCGGCAAGGAGGCCGGCATGCTCCAGCAGCAGACGTCCGTCTTCCAGTGG
CACGACGTCTGCTACGACATCAAGATCAAGGGCGAGCCGCGGCGCATCCTGGACAACGTGGACGGGTGGGTCAAG
CCCGGCACCCTCACCGCCCTCATGGGCGTGTCCGGGGCCGGCAAGACGACGCTGCTGGACTGCCTGGCGGACCGC
ACGTCGATGGGCGTCATCACGGGTGAGATGCTCGTCGACGGCAAGCCCCGCGATATGTCCTTCCAGCGCAAGACC
GGTTACGTCCAGCAGCAGGACCTGCACCTGCAGACGACGACGGTCCGCGAGGCCCTCAACTTCAGCGCCGTCCTG
CGTCAGCCCGCTCATATACCTAGGGACGAGAAGCTAGCCTACGTCGAGGAGGTCATCAAGCTCCTAGAGATGGAA
GAGTATGCCGATGCCGTCGTCGGCGTCCCGGGCGAGGGTCTGAACGTCGAGCAGCGCAAGCGCCTCACCATCGGG
GTCGAGCTGGCCGCCAAGCCGCCGCTCCTGCTCTTCGTCGACGAGCCGACGTCGGGCCTCGACTCGCAGACGTCC
TGGGCCATCCTGGACCTGCTCGAGAAGCTGACCAAGGCGGGCCAGGCCGTCCTGTGCACCATCCACCAGCCGTCG
GCCATGCTGTTCCAGCGCTTCGACCGGCTCCTCTTCCTGGCCAAGGGCGGCAAGACGGTCTACTTCGGCGACATC
GGCGAGAACTCCAAGACGATGACGGGCTACTTCGAGCGCAACGGCGGGCACCCCTGTCCCGCCGAGGCGAATCCG
GCCGAGTGGATGCTCGAGGTGATCGGGGCGGCGCCCGGAACGACGACGGAGATCGACTGGTTCAAGACGTGGCGA
GCGAGCCCCGAGTACGGGGCCGTGCAGGCCGAGCTCGACAACATCAAGCAGCAGAAGCAGGGGACGACCGAGGCC
GCCGACGACGACGACGACGACGCCGGGCGGTACCGCGAGTTCGCGGCGCCGTTCGCGGTGCAGCTGCGGGAGAAC
CTGTTCCGGGTCTTCCAGCAGTACTGGCGCACGCCGGTCTACATCTACGCCAAGACGGCGCTCTGCACGCTCGTC
GCCCTCTTCATCGGCTTCATCTTCTTCAAGGCGCCGCTGACGATCCAGGGGCTGAGCAACCAGATGTTCTCCATC
TTCCAGCTGCTGACCGTGTTCGGGCAGATCGTGCAGCAGTCGATGCCGCAGTTCGTGATCCAGCGGTCGCTGTAC
GAGGCGCGCGAGCGGCCGTCCAAGGTGTACTCGTGGAAGGTCTTCATGCTGTCGCAGATCATCGTGGAGCTGCCG
TGGAACGCGCTGATGGCGCTGCTCATGTACGTCTGCTGGTACTACCCGGTCGGGCTGTACGCCAACGCGGTGCCG
ACGGGCGACGTGGCCGAGCGCGGCGCGCTCACCTTCCTGTACCTGCTCATGTTCATGCTCTTCACCGGCACCTTC
TCGACGCTCGTCATCGCCGGCTTCGAGACGGCCGAGGCCGGCGGCAACCTGGCCAACCTCATGTTCACCCTCTGC
CTCATCTTCTGCGGCGTCCTCGCCACGCCCCAGTCGCTGCCGGGCTTCTGGATCTTCCTCTACCGCCTCTCGCCC
TTCACCTACCTCGTCTCGGGCCTGCTGGCGACGGGCATCGGCAACGCCCAGGTCCGCTGCGCCGACAACGAGCTG
CTGCACTTCCGCCCGCCCGCCAACCAGACGTGCGGCGAGTACCTGACGCCCTTCGACCGCCTCGCCGGCGGCCGC
GTCCTGCGGCCCGAGGCCACCGACCTCTGCTCCTACTGCCCGCTCGCCGACACCAACTCCTTCCTCGCCGGCGTC
AGCAGCAGCTACGCCGACCGCTGGCGCAACTTTGGCATCCTCTGGGCCTACATCGTCTTCAACATCGCCGCCGCC
CTCTTCGTCTACTGGCTGGCGCGCATGCCCAAGAAGAGCCTCGGCAAGGGCAAGAAGAAGAAGGAGTAG
Gene >Hirsu2|10900
CTGGCCCGCTCCTACTCGCGCACCTCGGCCGCCGTCCCGGGCCAGAACCCGTTCCTGGCCGGCTCCGACTCGCAC
CTCAACCCGAGCTCGCCCAACTTCAGCGGCCGCGAATGGGCCAAGGCCGTCGTCGAGCTCGTCTCCCACGACGGC
GGCTCCTTCCGCTCCACCGGCGTCTGCTTCGACAGCCTCAACGTCTACGGCTACGGCGAGTCCACCGACTACCAA
AAGGACGTCGCCAACATTTGGCTCTCCGCCGCCGCCCTCGCCCGCCGCTTCGCCGGCTCGGGCCGCCAGCGCATC
GACATCCTGCGCAACTTCGACGGCCTCGTCCGCACCGGCGAGATGCTCGTCGTCCTCGGCCCTCCCGGCTCCGGC
TGCTCCACCTTTCTCAAGACCATCGCCGGCGAGATGAACGGCATCTACGTCGACGACGGGTCCTACTTTAATTAC
CAAGGTCAGTCAACCTTGCCCCATGCCTCCCGCTCTCCTCTCTCTTTTCTTTTCGGCCTCAATTGCCGCCTGTCC
GCCCGTCCATTGGACGCAACATGTCGTGCTGCCCCAGATCTGCCACGCTTGACCCCCCTCCCCCCTTACCTTAAA
AATCCGAGCAAACTAGGACCCACGCGGGTCTTCGTTCCACTGAGATCGAACCGGGGGGCTTGCACGGCATCTTCC
GCCCGCTGCCCATACGATCCATGGCTTTTGTTTCGTGCTCGAGTCGCTGACATCGTCGACGCCCAGGCATGACGG
CCCGGGAGATGCATACGGACCACCGCGGCGAGGCCATCTACACCGCCGAGGTCGACGTCCATTTCCCCCAGCTGA
CCGTCGGCGATACCCTCACCTTCGCCGCACGGGCCCGCCAGCCCCGCCAGCTGCCCGAGGGTCTGAACAGGAATG
AGTTCGCCAACCACCTCCGCGACGTCGTCATGGCCATGTTCGGCATCTCCCACACCATCGACACCCGCGTCGGCA
ACGAGTATGTCCGCGGCGTGTCGGGCGGCGAGCGCAAGCGCGTCACCATCTCCGAGGCCGCCCTGTCTGGCGCCC
CGTTGCAGTGCTGGGACAACTCGACCCGTGGCCTCGACTCGGCCAACGCCATCGAGTTCTGCCGCACGCTGCGGC
TGCAGACGGAGCTCTTCAACAGCACCGCCTGCGTCTCCATCTACCAGGCCCCCCAGAGCGCCTACGACCTCTTCG
ACAAGGCCGCCGTCCTCTACGAGGGCCGCCAGATCTTCTTCGGCCGCGCCGACGCCGCCAAGCAGTACTTCATCA
ACCTCGGCTTCGAGTGCCCGCCGCGCCAGACCACGCCCGACTTCCTCACCTCCATGACCTCCTCCCTCGAGCGCA
TCGTCCGGCCAGGCTTCGAGGCCAAGGCCCCGCGCACCCCCGACGAGTTCGCCGACGCGTGGAGGGCGAGCGCCG
AGTACAAGGCTCTGCAGAAGGAGATTGAGGAATACAAGGCCGCCCACCCCATCGACGGCCCCGACGCCGCCCTCT
TCCGCGCCTCCCGCCGCGCTCAGCAGGCCAAGGGCCAGCGCAAAAGGTCCCCCTACACCCTGTCCTACGCCCAGC
AGGTGCAGCTGTGCCTCTGGCGCGGCTGGAAGCGCTTGACGGGCGACCCGAGCCTGACTGTCGGCGCCCTCATCG
GCAACTTTGCCATGGCCCTGATCATCGGCAGTGTCTTCTTCAATCTCAACGACACCACCTCGAGCTTCTTCCAAC
GCGGCGCCCTGCTGTTCTTTGCCTGTCTGATGAATGCATTCGCCTCTGCTCTGGAGGTGAGCTGCCCCCTTCCCT
TTCCGATACGCCGCCGGCGTGTAGCAGATGACTGACGCAACCATCCAAAACGCAGATCTTGACTCTGTATGCGCA
ACGGCCCATCGTGGAAAAGCATAGCCGATATGCCTTGTATCATCCGTCCGCCGAGGCCATTGCGTCTATGCTATG
CGACATGCCCTACAAGATTGCCAATACCATCGTCTTCAACCTGACCCTGTACTTCATGACCAATCTACGCAGGGA
GCCGGGCGCCTTCTTCTTCTTCCTGCTCATCACCTTCAGCACCGTCCTGGTCATGTCTATGATCTTCCGGACCAT
CGCATCGGCATCGCGCACCCTGTTCCAGGCCCTCGTCCCGGCCGCCATCCTGATCCTCGATCTGGTCATCTTCAC
CGGCTTCGTCCTTCCCAAGCGATACATGCTGGGCTGGTGCAAGTGGCTGAGCTACATCGACCCCTTGGGCTACGC
CTTCGAGGCCCTCATGGTCAACGAGTTTCACAACCGCCGCTTCCCGTGCTCGCAGTTCGTGCCCTCGTCGACGCC
GACCGTACCCGGGTCCGCCGGCGCGCTCGCCAAGTACGCCAACGTGGGCCCCGAGAACCGCATCTGCAACGCCGT
CGGCTCCGCCCAGGGCCAGAACTTCGTCGACGGCGACGTCTACGTCAAGTCAAGCTTCGACTACGAATGGGACCA
CCGCTGGCGCAACTTTGGCTTCGTCATCGCCTTCACCGCCTTCTTCCTCCTCTGCTACATGGTGGCCGCCGAGCT
GGTGTCGGAGAAGAAGTCCAAGGGCGAGGTCCTGGTCTACCGCCGGGGCCACAAACCCGCCGCCGCCAAGCACGC
CGAGAAGAGGCAGCGCGATCCCGAGGCCGCCATGGCCAACATCGGCCCCGTCGTCACGGCGGAGAGGAGCCGCGC
CGGCGCCGGCGGCGGCAAGGAGGCCGGCATGCTCCAGCAGCAGACGTCCGTCTTCCAGTGGCACGACGTCTGCTA
CGACATCAAGATCAAGGGCGAGCCGCGGCGCATCCTGGACAACGTGGACGGGTGGGTCAAGCCCGGCACCCTCAC
CGCCCTCATGGGCGTGTCCGGGGCCGGCAAGACGACGCTGCTGGACTGCCTGGCGGACCGCACGTCGATGGGCGT
CATCACGGGTGAGATGCTCGTCGACGGCAAGCCCCGCGATATGTCCTTCCAGCGCAAGACCGGTTACGTCCAGCA
GCAGGACCTGCACCTGCAGACGACGACGGTCCGCGAGGCCCTCAACTTCAGCGCCGTCCTGCGTCAGCCCGCTCA
TATACCTAGGGACGAGAAGCTAGCCTACGTCGAGGAGGTCATCAAGCTCCTAGAGATGGAAGAGTATGCCGATGC
CGTCGTCGGCGTCCCGGGCGAGGGTCTGAACGTCGAGCAGCGCAAGCGCCTCACCATCGGGGTCGAGCTGGCCGC
CAAGCCGCCGCTCCTGCTCTTCGTCGACGAGCCGACGTCGGGCCTCGACTCGCAGACGTCCTGGGCCATCCTGGA
CCTGCTCGAGAAGCTGACCAAGGCGGGCCAGGCCGTCCTGTGCACCATCCACCAGCCGTCGGCCATGCTGTTCCA
GCGCTTCGACCGGCTCCTCTTCCTGGCCAAGGGCGGCAAGACGGTCTACTTCGGCGACATCGGCGAGAACTCCAA
GACGATGACGGGCTACTTCGAGCGCAACGGCGGGCACCCCTGTCCCGCCGAGGCGAATCCGGCCGAGTGGATGCT
CGAGGTGATCGGGGCGGCGCCCGGAACGACGACGGAGATCGACTGGTTCAAGACGTGGCGAGCGAGCCCCGAGTA
CGGGGCCGTGCAGGCCGAGCTCGACAACATCAAGCAGCAGAAGCAGGGGACGACCGAGGCCGCCGACGACGACGA
CGACGACGCCGGGCGGTACCGCGAGTTCGCGGCGCCGTTCGCGGTGCAGCTGCGGGAGAACCTGTTCCGGGTCTT
CCAGCAGTACTGGCGCACGCCGGTCTACATCTACGCCAAGACGGCGCTCTGCACGCTCGTCGCCCTCTTCATCGG
CTTCATCTTCTTCAAGGCGCCGCTGACGATCCAGGGGCTGAGCAACCAGATGTTCTCCATCTTCCAGCTGCTGAC
CGTGTTCGGGCAGATCGTGCAGCAGTCGATGCCGCAGTTCGTGATCCAGCGGTCGCTGTACGAGGCGCGCGAGCG
GCCGTCCAAGGTGTACTCGTGGAAGGTCTTCATGCTGTCGCAGATCATCGTGGAGCTGCCGTGGAACGCGCTGAT
GGCGCTGCTCATGTACGTCTGCTGGTACTACCCGGTCGGGCTGTACGCCAACGCGGTGCCGACGGGCGACGTGGC
CGAGCGCGGCGCGCTCACCTTCCTGTACCTGCTCATGTTCATGCTCTTCACCGGCACCTTCTCGACGCTCGTCAT
CGCCGGCTTCGAGACGGCCGAGGCCGGCGGCAACCTGGCCAACCTCATGTTCACCCTCTGCCTCATCTTCTGCGG
CGTCCTCGCCACGCCCCAGTCGCTGCCGGGCTTCTGGATCTTCCTCTACCGCCTCTCGCCCTTCACCTACCTCGT
CTCGGGCCTGCTGGCGACGGGCATCGGCAACGCCCAGGTCCGCTGCGCCGACAACGAGCTGCTGCACTTCCGCCC
GCCCGCCAACCAGACGTGCGGCGAGTACCTGACGCCCTTCGACCGCCTCGCCGGCGGCCGCGTCCTGCGGCCCGA
GGCCACCGACCTCTGCTCCTACTGCCCGCTCGCCGACACCAACTCCTTCCTCGCCGGCGTCAGCAGCAGCTACGC
CGACCGCTGGCGCAACTTTGGCATCCTCTGGGCCTACATCGTCTTCAACATCGCCGCCGCCCTCTTCGTCTACTG
GCTGGCGCGCATGCCCAAGAAGAGCCTCGGCAAGGGCAAGAAGAAGAAGGAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail