Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|109
Gene name
LocationContig_1015:4508..4958
Strand-
Gene length (bp)450
Transcript length (bp)378
Coding sequence length (bp)378
Protein length (aa) 126

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Signal peptide 0.4984 0.3265 0.3371 0.2115 0.3901 0.0581 0.2967 0.3054 0.3216 0.2936

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup8622
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|109 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|109
MGMLAPGRSRSREPRDSWRLAQRLDRQASAKGGEWARSGGHMGVARDVVAVGASREPEAARADVGSGKGEKTGPG
GYGAATHQLRHEQALDGELQAPGPGTFGGLGVGLLTGAAVTAVKAHVQYT*
Coding >Hirsu2|109
ATGGGCATGCTCGCTCCCGGCCGATCGAGAAGCAGGGAGCCTCGCGACAGCTGGCGACTTGCGCAGCGCCTCGAC
CGACAGGCTAGCGCCAAAGGGGGGGAATGGGCCCGCTCCGGTGGGCACATGGGCGTGGCGCGCGACGTGGTGGCC
GTCGGGGCCAGTCGTGAACCTGAGGCCGCACGTGCCGACGTGGGCTCGGGAAAGGGGGAGAAGACGGGGCCGGGC
GGCTACGGCGCGGCGACTCATCAGCTCAGGCACGAACAGGCCCTGGATGGGGAGCTACAGGCCCCGGGCCCGGGG
ACCTTTGGCGGACTCGGAGTTGGGCTCCTTACAGGGGCCGCCGTCACCGCCGTCAAGGCGCACGTACAGTATACA
TAG
Transcript >Hirsu2|109
ATGGGCATGCTCGCTCCCGGCCGATCGAGAAGCAGGGAGCCTCGCGACAGCTGGCGACTTGCGCAGCGCCTCGAC
CGACAGGCTAGCGCCAAAGGGGGGGAATGGGCCCGCTCCGGTGGGCACATGGGCGTGGCGCGCGACGTGGTGGCC
GTCGGGGCCAGTCGTGAACCTGAGGCCGCACGTGCCGACGTGGGCTCGGGAAAGGGGGAGAAGACGGGGCCGGGC
GGCTACGGCGCGGCGACTCATCAGCTCAGGCACGAACAGGCCCTGGATGGGGAGCTACAGGCCCCGGGCCCGGGG
ACCTTTGGCGGACTCGGAGTTGGGCTCCTTACAGGGGCCGCCGTCACCGCCGTCAAGGCGCACGTACAGTATACA
TAG
Gene >Hirsu2|109
ATGGGCATGCTCGCTCCCGGCCGATCGAGAAGCAGGGAGCCTCGCGACAGCTGGCGACTTGCGCAGCGCCTCGAC
CGACAGGCTAGCGCCAAAGGGGGGGAATGGGCCCGCTCCGGTGGGCACATGGGCGTGGCGCGCGACGTGGTGGCC
GTCGGGGCCAGTCGTGAACCTGAGGCCGCACGTGCCGACGTGGGCTCGGGAAAGGGGGAGAAGACGGGGCCGGGC
GGCTACGGCGCGGCGACTCATCAGCTCAGGCACGAACAGGCCCTGGATGGGGAGCTACAGGCCCCGGGCCCGGGG
ACCTTTGGCGGACTCGGGTACTTGCCCTGCCAGGCAGGCAGATTGCCCAGGTACCTAGGCACCTAGATATGTACC
TACATACAGTACAGAGTTGGGCTCCTTACAGGGGCCGCCGTCACCGCCGTCAAGGCGCACGTACAGTATACATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail